Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $85,694.25
PubMed Score 2.18
PubTator Score 2.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7L2Z9 A8KAF1 Q6IN61 Q9NVS5 CENP-Q
Symbols CENP-Q
C6orf139

Gene

 Grant Application (1)

Gene RIF (4)

PMID Text
25670858 Plk1 regulates the timing of the delocalization and ultimate destruction of the PBIP1.CENP-Q complex.
25395579 CENP-Q - a subunit of the CENP-O complex (comprising CENP-O, CENP-P, CENP-Q and CENP-U) that targets polo-like kinase (Plk1) to kinetochores - is also required for the recruitment of CENP-E to kinetochores.
23028590 Data propose that CENP-P/O/R/Q/U self-assembles on kinetochores with varying stoichiometry and undergoes a pre-mitotic maturation step that could be important for kinetochores switching into the correct conformation for microtubule-attachment.
21454580 Mammalian polo-like kinase 1-dependent regulation of the PBIP1-CENP-Q complex at kinetochores.

AA Sequence

MSGKANASKKNAQQLKRNPKRKKDNEEVVLSENKVRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKR      1 - 70
KTWQPLSKSTRDHLQTMMESVIMTILSNSIKEKEEIQYHLNFLKKRLLQQCETLKVPPKKMEDLTNVSSL     71 - 140
LNMERARDKANEEGLALLQEEIDKMVETTELMTGNIQSLKNKIQILASEVEEEEERVKQMHQINSSGVLS    141 - 210
LPELSQKTLKAPTLQKEILALIPNQNALLKDLDILHNSSQMKSMSTFIEEAYKKLDAS                211 - 268
//

Text Mined References (13)

PMID Year Title
25670858 2015 Mammalian Polo-like kinase 1 (Plk1) promotes proper chromosome segregation by phosphorylating and delocalizing the PBIP1·CENP-Q complex from kinetochores.
25395579 2015 Chromosome congression is promoted by CENP-Q- and CENP-E-dependent pathways.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028590 2012 Step-wise assembly, maturation and dynamic behavior of the human CENP-P/O/R/Q/U kinetochore sub-complex.
21454580 2011 Mammalian polo-like kinase 1-dependent regulation of the PBIP1-CENP-Q complex at kinetochores.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
16622420 2006 The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...