Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Renal Cell Carcinoma 199
Disease Target Count P-value
glioblastoma multiforme 347 1.5787954188891E-21
osteosarcoma 7933 4.20796818569479E-6
sonic hedgehog group medulloblastoma 1482 1.08141828340591E-5
pediatric high grade glioma 2712 3.31380075687055E-5
aldosterone-producing adenoma 664 0.00745902276209637
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00996403588913657
astrocytic glioma 2241 0.0411121981835193
Disease Target Count Z-score Confidence
Renal oncocytoma 22 4.341 2.2

Expression

Synonym

Accession Q7L2R6 A8MYG0 B4DF18 B7ZAI5 B9EIL1 Q9BV49
Symbols

Gene

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMKEFSSTAQGNREVFH      1 - 70
AGTSQRHESHHNGDFCFQDIDKDIHDIEFQWQEDERNGHEALMTKIKKLTGSTERYDQNYAGNKPVKYQL     71 - 140
GFSFHSHLPELHIFHTEEKIDNQVVKSIHDASLVSTAQRISCRPETHISNDYGNNFLNSSLFTQKQEVHM    141 - 210
REKSFQCNDSGKAYNCSSLLRKHQLIHLGEKQYKCDICGKVFNSKRYVARHRRCHTGEKPYKCNECGKTF    211 - 280
SQTYYLTCHRRLHTGEKPYKCEECDKAFHFKSKLQIHRRIHTGEKPYKCNECGKTFSQKSYLTCHRRLHT    281 - 350
GEKPYKCNECGKTFSRKSHFTCHHRVHTGEKPYKCNECSKTFSHKSSLTYHRRLHTEEKPYKCNECGKTF    351 - 420
NQQLTLNICRLHSGEKPYKCEECDKAYSFKSNLEIHQKIHTEENPYKCNECGKTFSRTSSLTYHHRLHTG    421 - 490
QKPYKCEDCDEAFSFKSNLERHRRIYTGEKLHV                                         491 - 523
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.