Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.40
PubTator Score 0.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.2e-34
Disease Target Count Z-score Confidence
Central nervous system lymphoma 5 3.764 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 2.2e-34

AA Sequence

MLPAGCSRRLVAELQGALDACAQRQLQLEQSLRVCRRLLHAWEPTGTRALKPPPGPETNGEDPLPACTPS      1 - 70
PQDLKELEFLTQALEKAVRVRRGITKAGERDKAPSLKSRSIVTSSGTTASAPPHSPGQAGGHASDTRPTK     71 - 140
GLRQTTVPAKGHPERRLLSVGDGTRVGMGARTPRPGAGLRDQQMAPSAAPQAPEAFTLKEKGHLLRLPAA    141 - 210
FRKAASQNSSLWAQLSSTQTSDSTDAAAAKTQFLQNMQTASGGPQPRLSAVEVEAEAGRLRKACSLLRLR    211 - 280
MREELSAAPMDWMQEYRCLLTLEGLQAMVGQCLHRLQELRAAVAEQPPRPCPVGRPPGASPSCGGRAEPA    281 - 350
WSPQLLVYSSTQELQTLAALKLRVAVLDQQIHLEKVLMAELLPLVSAAQPQGPPWLALCRAVHSLLCEGG    351 - 420
ARVLTILRDEPAV                                                             421 - 433
//

Text Mined References (5)

PMID Year Title