Property Summary

NCBI Gene PubMed Count 19
Grant Count 3
R01 Count 3
Funding $1,192,500
PubMed Score 37.37
PubTator Score 22.97

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7L2H7 A8K7X4 B4E2Q4 O60735 Q2F836 Q53HL6 Q9BXW1 eIF3m
Symbols B5
GA17
PCID1
TANGO7
hfl-B5

Gene

PDB

3J8B   3J8C  

Gene RIF (9)

PMID Text
22190034 HIV-1 Rev interacting protein, eukaryotic translation initiation factor 3, subunit M (EIF3M), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa. The interaction of Rev with EIF3M is decreased by RRE
22174317 HIV-1 Rev interacting protein, eukaryotic translation initiation factor 3, subunit M (EIF3M), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa. The interaction of Rev with EIF3M is decreased by RRE
22022972 POLR2J interacts with three different subunits of eIF3, eIF3a, eIF3i, and eIF3m.
20838379 eIF3m mediates regulation of tumorigenesis-related genes in human colon cancer
20676407 Results demonstrate that B5 plays a major role in the initiation of HSV protein translation and could provide a novel target for strategies to prevent primary and recurrent herpetic disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19483676 the human Tango7 counterpart, PCID1 (also known as EIF3M), impinged on caspase 9, revealing a new regulatory axis affecting the apoptosome
15919899 Concluded that the C terminus of B5 contains a functional region that is important for the B5 receptor to mediate events in HSV entry.
15919898 Cloned a previously uncharacterized human gene, designated hfl-B5, and showed that it encodes a type II cell surface membrane protein that can serve as a receptor for entry of HSV.

AA Sequence

MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSL      1 - 70
LLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYI     71 - 140
PTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVR    141 - 210
ALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLL    211 - 280
TFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQL    281 - 350
YDTLNAWKQNLNKVKNSLLSLSDT                                                  351 - 374
//

Text Mined References (37)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22190034 2011 Global landscape of HIV-human protein complexes.
22022972 2011 A minor isoform of the human RNA polymerase II subunit hRPB11 (POLR2J) interacts with several components of the translation initiation factor eIF3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...