Property Summary

NCBI Gene PubMed Count 22
PubMed Score 41.16
PubTator Score 22.97

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (10)

Gene RIF (9)

AA Sequence

MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSL      1 - 70
LLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYI     71 - 140
PTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVR    141 - 210
ALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLL    211 - 280
TFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQL    281 - 350
YDTLNAWKQNLNKVKNSLLSLSDT                                                  351 - 374
//

Text Mined References (40)

PMID Year Title