Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.61
PubTator Score 5.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.01058216047815E-7
glioblastoma 5572 6.95538647577045E-5
Pick disease 1893 7.63190604014295E-5
medulloblastoma, large-cell 6234 4.16631365370651E-4
adult high grade glioma 2148 0.00299491812931293
astrocytic glioma 2241 0.0079842950708585
Breast cancer 3099 0.0215510499526643
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 0.008
osteosarcoma -1.349 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -1.100 0.000
Breast cancer 3.500 0.022
adult high grade glioma -1.300 0.003
Pick disease 1.200 0.000

Synonym

Accession Q7L2E3 A8K5F1 O94965 Q7Z753 Q96CH4 Q9NUQ0
Symbols DDX30
RETCOR

Gene

PDB

2DB2  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify DEAH (Asp-Glu-Ala-His) box polypeptide 30 (DHX30), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18063578 Identifies DHX30 as a nucleoid protein.
18022663 Here, we provide evidence that overexpression of an RNA helicase named DHX30 enhances HIV-1 gene expression, but leads to the generation of viruses that package significantly low levels of viral RNA and exhibit severely decreased infectivity.

AA Sequence

MFSLDSFRKDRAQHRQRQCKLPPPRLPPMCVNPTPGGTISRASRDLLKEFPQPKNLLNSVIGRALGISHA      1 - 70
KDKLVYVHTNGPKKKKVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYR     71 - 140
VLADRFGSPADSWWRPEPTMPPTSWRQLNPESIRPGGPGGLSRSLGREEEEDEEEELEEGTIDVTDFLSM    141 - 210
TQQDSHAPLRDSRGSSFEMTDDDSAIRALTQFPLPKNLLAKVIQIATSSSTAKNLMQFHTVGTKTKLSTL    211 - 280
TLLWPCPMTFVAKGRRKAEAENKAAALACKKLKSLGLVDRNNEPLTHAMYNLASLRELGETQRRPCTIQV    281 - 350
PEPILRKIETFLNHYPVESSWIAPELRLQSDDILPLGKDSGPLSDPITGKPYVPLLEAEEVRLSQSLLEL    351 - 420
WRRRGPVWQEAPQLPVDPHRDTILNAIEQHPVVVISGDTGCGKTTRIPQLLLERYVTEGRGARCNVIITQ    421 - 490
PRRISAVSVAQRVSHELGPSLRRNVGFQVRLESKPPSRGGALLFCTVGILLRKLQSNPSLEGVSHVIVDE    491 - 560
VHERDVNTDFLLILLKGLQRLNPALRLVLMSATGDNERFSRYFGGCPVIKVPGFMYPVKEHYLEDILAKL    561 - 630
GKHQYLHRHRHHESEDECALDLDLVTDLVLHIDARGEPGGILCFLPGWQEIKGVQQRLQEALGMHESKYL    631 - 700
ILPVHSNIPMMDQKAIFQQPPVGVRKIVLATNIAETSITINDIVHVVDSGLHKEERYDLKTKVSCLETVW    701 - 770
VSRANVIQRRGRAGRCQSGFAYHLFPRSRLEKMVPFQVPEILRTPLENLVLQAKIHMPEKTAVEFLSKAV    771 - 840
DSPNIKAVDEAVILLQEIGVLDQREYLTTLGQRLAHISTDPRLAKAIVLAAIFRCLHPLLVVVSCLTRDP    841 - 910
FSSSLQNRAEVDKVKALLSHDSGSDHLAFVRAVAGWEEVLRWQDRSSRENYLEENLLYAPSLRFIHGLIK    911 - 980
QFSENIYEAFLVGKPSDCTLASAQCNEYSEEEELVKGVLMAGLYPNLIQVRQGKVTRQGKFKPNSVTYRT    981 - 1050
KSGNILLHKSTINREATRLRSRWLTYFMAVKSNGSVFVRDSSQVHPLAVLLLTDGDVHIRDDGRRATISL   1051 - 1120
SDSDLLRLEGDSRTVRLLKELRRALGRMVERSLRSELAALPPSVQEEHGQLLALLAELLRGPCGSFDVRK   1121 - 1190
TADD                                                                     1191 - 1194
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25683715 2015 Mitochondrial RNA Granules Are Centers for Posttranscriptional RNA Processing and Ribosome Biogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23098562 2013 In pursuit of synthetic modulators for the orphan retina-specific nuclear receptor NR2E3.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21278163 2011 TEFM (c17orf42) is necessary for transcription of human mtDNA.
More...