Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.70
PubTator Score 3.24

Knowledge Summary


No data available


  Disease (2)


  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.700 4.0e-15
intraductal papillary-mucinous neoplasm ... 1.500 1.3e-02
ovarian cancer -1.900 8.3e-05
posterior fossa group A ependymoma 1.200 2.6e-06
spina bifida -1.293 4.4e-02


Accession Q7L273 Q6NUM8 Q9NXV4
Symbols BTBD27




  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

ENCDLSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR                                   351 - 389

Text Mined References (12)

PMID Year Title