Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.70
PubTator Score 3.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.700 4.0e-15
intraductal papillary-mucinous neoplasm ... 1.500 1.3e-02
ovarian cancer -1.900 8.3e-05
posterior fossa group A ependymoma 1.200 2.6e-06
spina bifida -1.293 4.4e-02

Gene RIF (3)

AA Sequence

MRRVTLFLNGSPKNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDDDVLFVCEGEPF      1 - 70
IDPQTDSKPPEGLLGFHTDWLTLNVGGRYFTTTRSTLVNKEPDSMLAHMFKDKGVWGNKQDHRGAFLIDR     71 - 140
SPEYFEPILNYLRHGQLIVNDGINLLGVLEEARFFGIDSLIEHLEVAIKNSQPPEDHSPISRKEFVRFLL    141 - 210
ATPTKSELRCQGLNFSGADLSRLDLRYINFKMANLSRCNLAHANLCCANLERADLSGSVLDCANLQGVKM    211 - 280
LCSNAEGASLKLCNFEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDL    281 - 350
ENCDLSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR                                   351 - 389
//

Text Mined References (12)

PMID Year Title