Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.64
PubTator Score 3.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.500 0.013
posterior fossa group B ependymoma 1.300 0.000
spina bifida -1.293 0.044
Breast cancer -1.700 0.000
ovarian cancer -1.900 0.000

Gene RIF (3)

PMID Text
26334369 The authors find that the KCTD proteins 5, 6, 9 and 17 bind to Cul3 with high affinity, while the KCTD proteins 1 and 16 do not have detectable binding.
23376586 These results suggest the involvement of KCTD9 in NK cell activation and provide additional insight into a potential therapeutic target for molecular manipulation for hepatitis B virus-induced acute-on-chronic liver failure patients
19032868 The increased expression of potassium channel gene KCTD9 correlates with disease severity in patients with viral hepatitis B.

AA Sequence

MRRVTLFLNGSPKNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDDDVLFVCEGEPF      1 - 70
IDPQTDSKPPEGLLGFHTDWLTLNVGGRYFTTTRSTLVNKEPDSMLAHMFKDKGVWGNKQDHRGAFLIDR     71 - 140
SPEYFEPILNYLRHGQLIVNDGINLLGVLEEARFFGIDSLIEHLEVAIKNSQPPEDHSPISRKEFVRFLL    141 - 210
ATPTKSELRCQGLNFSGADLSRLDLRYINFKMANLSRCNLAHANLCCANLERADLSGSVLDCANLQGVKM    211 - 280
LCSNAEGASLKLCNFEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDL    281 - 350
ENCDLSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR                                   351 - 389
//

Text Mined References (12)

PMID Year Title
26334369 2016 Structural Insights into KCTD Protein Assembly and Cullin3 Recognition.
25416956 2014 A proteome-scale map of the human interactome network.
23376586 2013 KCTD9 contributes to liver injury through NK cell activation during hepatitis B virus-induced acute-on-chronic liver failure.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19032868 2008 [Increased expression of KCTD9, a novel potassium channel related gene, correlates with disease severity in patients with viral hepatitis B].
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...