Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.64
PubTator Score 3.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 3.99001557009772E-15
posterior fossa group B ependymoma 1530 6.03630141071603E-5
ovarian cancer 8492 8.30284848004804E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0134698500606175
spina bifida 1064 0.0435677332899902
Disease Target Count Z-score Confidence
Viral hepatitis 1 3.658 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.500 0.013
posterior fossa group B ependymoma 1.300 0.000
spina bifida -1.293 0.044
Breast cancer -1.700 0.000
ovarian cancer -1.900 0.000

Synonym

Accession Q7L273 Q6NUM8 Q9NXV4
Symbols BTBD27

Gene

PDB

5BXH  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (3)

PMID Text
26334369 The authors find that the KCTD proteins 5, 6, 9 and 17 bind to Cul3 with high affinity, while the KCTD proteins 1 and 16 do not have detectable binding.
23376586 These results suggest the involvement of KCTD9 in NK cell activation and provide additional insight into a potential therapeutic target for molecular manipulation for hepatitis B virus-induced acute-on-chronic liver failure patients
19032868 The increased expression of potassium channel gene KCTD9 correlates with disease severity in patients with viral hepatitis B.

AA Sequence

MRRVTLFLNGSPKNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDDDVLFVCEGEPF      1 - 70
IDPQTDSKPPEGLLGFHTDWLTLNVGGRYFTTTRSTLVNKEPDSMLAHMFKDKGVWGNKQDHRGAFLIDR     71 - 140
SPEYFEPILNYLRHGQLIVNDGINLLGVLEEARFFGIDSLIEHLEVAIKNSQPPEDHSPISRKEFVRFLL    141 - 210
ATPTKSELRCQGLNFSGADLSRLDLRYINFKMANLSRCNLAHANLCCANLERADLSGSVLDCANLQGVKM    211 - 280
LCSNAEGASLKLCNFEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDL    281 - 350
ENCDLSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR                                   351 - 389
//

Text Mined References (12)

PMID Year Title
26334369 2016 Structural Insights into KCTD Protein Assembly and Cullin3 Recognition.
25416956 2014 A proteome-scale map of the human interactome network.
23376586 2013 KCTD9 contributes to liver injury through NK cell activation during hepatitis B virus-induced acute-on-chronic liver failure.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19032868 2008 [Increased expression of KCTD9, a novel potassium channel related gene, correlates with disease severity in patients with viral hepatitis B].
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...