Property Summary

NCBI Gene PubMed Count 15
Grant Count 86
R01 Count 44
Funding $15,430,360.33
PubMed Score 971.04
PubTator Score 1582.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 3.000 0.000
astrocytic glioma -1.700 0.034
ependymoma -2.000 0.040
psoriasis 1.300 0.000
osteosarcoma -2.106 0.000
glioblastoma -1.700 0.001
sonic hedgehog group medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.200 0.000
tuberculosis 1.600 0.000
non-small cell lung cancer -1.363 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.042
lung cancer -2.900 0.000
active Crohn's disease 2.114 0.000
ulcerative colitis 2.500 0.000
interstitial cystitis 1.200 0.005
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.300 0.000
ovarian cancer 2.700 0.000

Synonym

Accession Q7L266 B2R7Q0 Q567Q4 Q6P1P0 Q8NI34 Q9H6F7
Symbols ALP
ALP1
CRASH

Gene

PANTHER Protein Class (2)

PDB

3TKJ   4ET0   4O0C   4O0D   4O0E   4O0F   4O0G   4O0H   4OSX   4OSY   4PVP   4PVQ   4PVR   4PVS   4ZM9  

Gene RIF (7)

PMID Text
26780688 Multiple negatively charged small molecules interact within the active site of ASRGL1 to act as a base in promoting cleavage.
25858696 Reduced expression of ASRGL1, defined as <75% positively stained tumor cells, was significantly associated with poor prognosis and reduced disease-specific survival in endometrioid endometrial adenocarcinoma (EEA).
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of asparaginase like 1 (ASRGL1) in peptide-treated PBMCs
22891768 Determined is the structure of the first mammalian plant-type asparaginase in both a precursor and fully activated form.
19839645 ASRGL1 exhibits beta-aspartyl peptidase activity consistent with plant-type asparaginases. ASRGL1 is shown to be an Ntn hydrolase for which Thr168 serves as the essential N-terminal nucleophile for intramolecular processing and catalysis.
19414332 Overexpression of CRASH is associated with metastatic breast cancer.
11984834 Human ALP cDNA was subsequently cloned. It showed 77% identity to the rat ALP sequence and the gene, ASRGL1 (asparaginase-like 1), mapped to chromosome locus 11q12.3.

AA Sequence

MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLN      1 - 70
TNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLV     71 - 140
TERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYAD    141 - 210
NDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTS    211 - 280
TSMPWAAAKDGKLHFGIDPDDTTITDLP                                              281 - 308
//

Text Mined References (19)

PMID Year Title
26780688 2016 Intramolecular Cleavage of the hASRGL1 Homodimer Occurs in Two Stages.
25858696 2015 Loss of ASRGL1 expression is an independent biomarker for disease-specific survival in endometrioid endometrial carcinoma.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
22891768 2012 Uncoupling intramolecular processing and substrate hydrolysis in the N-terminal nucleophile hydrolase hASRGL1 by circular permutation.
22861376 2012 Structures of apo and product-bound human L-asparaginase: insights into the mechanism of autoproteolysis and substrate hydrolysis.
21630459 2011 Proteomic characterization of the human sperm nucleus.
19839645 2009 The human asparaginase-like protein 1 hASRGL1 is an Ntn hydrolase with beta-aspartyl peptidase activity.
19414332 2009 Cell growth stimulation by CRASH, an asparaginase-like protein overexpressed in human tumors and metastatic breast cancers.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...