Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1069.08
PubTator Score 1582.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 2.059 6.1e-04
active ulcerative colitis 1.697 2.0e-03
adult high grade glioma -1.600 8.1e-04
astrocytic glioma -1.700 3.4e-02
Astrocytoma, Pilocytic -1.300 8.3e-07
atypical teratoid / rhabdoid tumor -1.700 2.5e-07
ependymoma -2.000 4.0e-02
glioblastoma -1.100 2.4e-05
interstitial cystitis 1.200 4.5e-03
intraductal papillary-mucinous adenoma (... -1.100 4.2e-02
lung cancer -2.000 1.7e-03
malignant mesothelioma 3.000 3.1e-08
medulloblastoma -1.100 4.3e-05
medulloblastoma, large-cell -1.400 2.5e-04
non-small cell lung cancer -1.363 2.8e-12
osteosarcoma -2.106 3.8e-05
ovarian cancer 2.700 1.8e-06
psoriasis 1.300 4.5e-04
tuberculosis 1.600 2.3e-07

Synonym

Accession Q7L266 B2R7Q0 Q567Q4 Q6P1P0 Q8NI34 Q9H6F7
Symbols ALP
ALP1
CRASH

Gene

PANTHER Protein Class (2)

PDB

3TKJ   4ET0   4O0C   4O0D   4O0E   4O0F   4O0G   4O0H   4OSX   4OSY   4PVP   4PVQ   4PVR   4PVS   4ZM9  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLN      1 - 70
TNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLV     71 - 140
TERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYAD    141 - 210
NDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTS    211 - 280
TSMPWAAAKDGKLHFGIDPDDTTITDLP                                              281 - 308
//

Text Mined References (21)

PMID Year Title