Property Summary

NCBI Gene PubMed Count 14
PubMed Score 253.25
PubTator Score 9.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.8e-08
osteosarcoma 7950 6.7e-06
medulloblastoma, large-cell 6241 7.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Detrusor sphincter dyssynergia 8 3.59 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.500 7.7e-04
osteosarcoma -2.197 6.7e-06
ovarian cancer -2.300 3.8e-08

Synonym

Accession Q7L1V2 B4DDZ0 O94949
Symbols SRG1
HSRG1
SAND2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MEVGGDTAAPAPGGAEDLEDTQFPSEEAREGGGVHAVPPDPEDEGLEETGSKDKDQPPSPSPPPQSEALS      1 - 70
STSRLWSPAAPENSPTCSPESSSGGQGGDPSDEEWRSQRKHVFVLSEAGKPIYSRYGSVEALSATMGVMT     71 - 140
ALVSFVQSAGDAIRAIYAEDHKLVFLQQGPLLLVAMSRTSQSAAQLRGELLAVHAQIVSTLTRASVARIF    141 - 210
AHKQNYDLRRLLAGSERTLDRLLDSMEQDPGALLLGAVRCVPLARPLRDALGALLRRCTAPGLALSVLAV    211 - 280
GGRLITAAQERNVLAECRLDPADLQLLLDWVGAPAFAAGEAWAPVCLPRFNPDGFFYAYVARLDAMPVCL    281 - 350
LLLGTQREAFHAMAACRRLVEDGMHALGAMRALGEAASFSNASSASAPAYSVQAVGAPGLRHFLYKPLDI    351 - 420
PDHHRQLPQFTSPELEAPYSREEERQRLSDLYHRLHARLHSTSRPLRLIYHVAEKETLLAWVTSKFELYT    421 - 490
CLSPLVTKAGAILVVTKLLRWVKKEEDRLFIRYPPKYSTPPATSTDQAAHNGLFTGL                 491 - 547
//

Text Mined References (20)

PMID Year Title