Property Summary

NCBI Gene PubMed Count 15
Grant Count 7
R01 Count 7
Funding $477,713.34
PubMed Score 16.79
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.203 0.000
glioblastoma 1.600 0.009
lung cancer -2.100 0.000
group 3 medulloblastoma 1.200 0.009
primary Sjogren syndrome 1.400 0.000
psoriasis 1.100 0.000

Gene RIF (9)

PMID Text
26878259 Cytosolic localization of NADH cytochrome b oxidoreductase
23523930 data provide first evidence for natural mutations in NCB5OR gene resulting in decreased protein levels and hence having potential implications in human pathology.
22627575 Mutation in cytochrome b5 reductase is associated with developmental delay and severe neurological problems.
20630863 Study of the individual cytochrome b5 and cytochrome b5 reductase domains of Ncb5or reveals a unique heme pocket and a possible role of the CS domain.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15504981 Observational study of gene-disease association. (HuGE Navigator)
15504981 Variaation in the coding region is not a major contributor in the pathogenesis of nonautoimmune diabetes.
15131110 NCB5OR is a novel soluble NAD(P)H reductase localized in the endoplasmic reticulum

AA Sequence

MLNVPSQSFPAPRSQQRVASGGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGRLIEVTEEELKKHNKKDD      1 - 70
CWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVNYESMLKECLVGRMAIKPAVLKDYR     71 - 140
EEEKKVLNGMLPKSQVTDTLAKEGPSYPSYDWFQTDSLVTIAIYTKQKDINLDSIIVDHQNDSFRAETII    141 - 210
KDCLYLIHIGLSHEVQEDFSVRVVESVGKIEIVLQKKENTSWDFLGHPLKNHNSLIPRKDTGLYYRKCQL    211 - 280
ISKEDVTHDTRLFCLMLPPSTHLQVPIGQHVYLKLPITGTEIVKPYTPVSGSLLSEFKEPVLPNNKYIYF    281 - 350
LIKIYPTGLFTPELDRLQIGDFVSVSSPEGNFKISKFQELEDLFLLAAGTGFTPMVKILNYALTDIPSLR    351 - 420
KVKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEFVLSAPISEWNGKQGHISPALLSEFLKRNLDKSKVLV    421 - 490
CICGPVPFTEQGVRLLHDLNFSKNEIHSFTA                                           491 - 521
//

Text Mined References (19)

PMID Year Title
26878259 2016 Cytosolic localization of NADH cytochrome b? oxidoreductase (Ncb5or).
23523930 2013 Natural mutations lead to enhanced proteasomal degradation of human Ncb5or, a novel flavoheme reductase.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22627575 2012 Methemoglobin reductase deficiency: novel mutation is associated with a disease phenotype of intermediate severity.
20630863 2010 Study of the individual cytochrome b5 and cytochrome b5 reductase domains of Ncb5or reveals a unique heme pocket and a possible role of the CS domain.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...