Property Summary

NCBI Gene PubMed Count 15
PubMed Score 17.53
PubTator Score 5.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.7e-15
osteosarcoma 7950 4.4e-09
lung cancer 4740 9.5e-05
primary Sjogren syndrome 735 2.0e-04
group 3 medulloblastoma 4104 9.0e-03
glioblastoma 5792 9.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Methemoglobinemia 17 5.344 2.7

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.600 9.2e-03
group 3 medulloblastoma 1.200 9.0e-03
lung cancer -2.100 9.5e-05
osteosarcoma -2.203 4.4e-09
primary Sjogren syndrome 1.400 2.0e-04
psoriasis 1.100 2.7e-15

Gene RIF (9)

AA Sequence

MLNVPSQSFPAPRSQQRVASGGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGRLIEVTEEELKKHNKKDD      1 - 70
CWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVNYESMLKECLVGRMAIKPAVLKDYR     71 - 140
EEEKKVLNGMLPKSQVTDTLAKEGPSYPSYDWFQTDSLVTIAIYTKQKDINLDSIIVDHQNDSFRAETII    141 - 210
KDCLYLIHIGLSHEVQEDFSVRVVESVGKIEIVLQKKENTSWDFLGHPLKNHNSLIPRKDTGLYYRKCQL    211 - 280
ISKEDVTHDTRLFCLMLPPSTHLQVPIGQHVYLKLPITGTEIVKPYTPVSGSLLSEFKEPVLPNNKYIYF    281 - 350
LIKIYPTGLFTPELDRLQIGDFVSVSSPEGNFKISKFQELEDLFLLAAGTGFTPMVKILNYALTDIPSLR    351 - 420
KVKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEFVLSAPISEWNGKQGHISPALLSEFLKRNLDKSKVLV    421 - 490
CICGPVPFTEQGVRLLHDLNFSKNEIHSFTA                                           491 - 521
//

Text Mined References (19)

PMID Year Title