Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.77
PubTator Score 3.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7L1S5 Q6UX69 Q9BXH3 Q9BXH4 Q9BZW9
Symbols GalNAc4ST2
GALNAC4ST-2

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
21156230 the copy number variations of CHST9 have been shown to associate with hematologic malignancies
8419650 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins
1433500 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins

AA Sequence

MQPSEMVMNPKQVFLSVLIFGVAGLLLFMYLQVWIEEQHTGRVEKRREQKVTSGWGPVKYLRPVPRIMST      1 - 70
EKIQEHITNQNPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQALSKSTGSPTEKLIEKRQGAK     71 - 140
TVFNKFSNMNWPVDIHPLNKSLVKDNKWKKTEETQEKRRSFLQEFCKKYGGVSHHQSHLFHTVSRIYVED    141 - 210
KHKILYCEVPKAGCSNWKRILMVLNGLASSAYNISHNAVHYGKHLKKLDSFDLKGIYTRLNTYTKAVFVR    211 - 280
DPMERLVSAFRDKFEHPNSYYHPVFGKAIIKKYRPNACEEALINGSGVKFKEFIHYLLDSHRPVGMDIHW    281 - 350
EKVSKLCYPCLINYDFVGKFETLEEDANYFLQMIGAPKELKFPNFKDRHSSDERTNAQVVRQYLKDLTRT    351 - 420
ERQLIYDFYYLDYLMFNYTTPFL                                                   421 - 443
//

Text Mined References (13)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
21156230 2010 Examination of copy number variations of CHST9 in multiple types of hematologic malignancies.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...