Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.45
PubTator Score 3.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Breast cancer -2.900 9.3e-22
adult high grade glioma 1.300 2.5e-02
astrocytic glioma 3.400 1.7e-03
Astrocytoma, Pilocytic 2.100 2.5e-04
chronic rhinosinusitis -1.758 4.7e-02
ependymoma 2.400 1.6e-02
glioblastoma 1.300 1.8e-02
interstitial cystitis -1.300 1.8e-02
intraductal papillary-mucinous adenoma (... -2.900 3.0e-04
intraductal papillary-mucinous carcinoma... -2.000 1.2e-02
intraductal papillary-mucinous neoplasm ... -2.700 3.3e-03
lung adenocarcinoma -1.100 2.4e-02
lung carcinoma 1.400 3.8e-02
nasopharyngeal carcinoma -3.200 1.9e-07
non-small cell lung carcinoma -1.100 3.1e-04
oligodendroglioma 1.600 1.4e-07
pancreatic cancer -1.300 1.5e-03
urothelial carcinoma -1.600 1.1e-02

Gene RIF (3)

AA Sequence

MQPSEMVMNPKQVFLSVLIFGVAGLLLFMYLQVWIEEQHTGRVEKRREQKVTSGWGPVKYLRPVPRIMST      1 - 70
EKIQEHITNQNPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQALSKSTGSPTEKLIEKRQGAK     71 - 140
TVFNKFSNMNWPVDIHPLNKSLVKDNKWKKTEETQEKRRSFLQEFCKKYGGVSHHQSHLFHTVSRIYVED    141 - 210
KHKILYCEVPKAGCSNWKRILMVLNGLASSAYNISHNAVHYGKHLKKLDSFDLKGIYTRLNTYTKAVFVR    211 - 280
DPMERLVSAFRDKFEHPNSYYHPVFGKAIIKKYRPNACEEALINGSGVKFKEFIHYLLDSHRPVGMDIHW    281 - 350
EKVSKLCYPCLINYDFVGKFETLEEDANYFLQMIGAPKELKFPNFKDRHSSDERTNAQVVRQYLKDLTRT    351 - 420
ERQLIYDFYYLDYLMFNYTTPFL                                                   421 - 443
//

Text Mined References (14)

PMID Year Title