Property Summary

NCBI Gene PubMed Count 20
Grant Count 4
Funding $27,333.5
PubMed Score 25.06
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.859 0.000
astrocytic glioma -2.400 0.014
ependymoma -2.800 0.019
oligodendroglioma -2.400 0.017
osteosarcoma -1.993 0.000
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
group 4 medulloblastoma -1.300 0.001
medulloblastoma, large-cell -1.900 0.001
autosomal dominant Emery-Dreifuss muscul... 1.071 0.003
juvenile dermatomyositis 1.401 0.000
acute quadriplegic myopathy 1.758 0.000
adrenocortical carcinoma -1.583 0.000
pancreatic ductal adenocarcinoma liver m... -1.557 0.007
lung cancer 1.100 0.013
Breast cancer 2.700 0.038
adult high grade glioma -1.700 0.000
pilocytic astrocytoma -1.200 0.001
psoriasis 1.200 0.000
ovarian cancer -1.600 0.000
pancreatic cancer 1.200 0.010
dermatomyositis 1.300 0.003

Gene RIF (3)

PMID Text
21734401 Data indicate taht candidate genes ACTB, BZW, OCM, MACC1, NXPH1, PRPS1L1, RAC1 and RPA3, which lie within the DFNB90 region, were sequenced and no potentially causal variants were identified.
19446954 BZW1 is a novel factor, promoting the growth of MEC cells
11524015 Stimulates cell cycle regulation of histone H4 gene transcription.

AA Sequence

MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETL      1 - 70
FDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLK     71 - 140
GFSESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVS    141 - 210
MDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKE    211 - 280
EMKKNNIPEPVVIGIVWSSVMSTVEWNKKEELVAEQAIKHLKQYSPLLAAFTTQGQSELTLLLKIQEYCY    281 - 350
DNIHFMKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD     351 - 419
//

Text Mined References (30)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21734401 2011 Novel autosomal recessive nonsyndromic hearing impairment locus DFNB90 maps to 7p22.1-p15.3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...