Property Summary

NCBI Gene PubMed Count 20
PubMed Score 25.06
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Melanoma 261
Disease Target Count P-value
psoriasis 6685 5.5730462885693E-58
juvenile dermatomyositis 1189 3.29058387575483E-12
acute quadriplegic myopathy 1157 2.07190137526098E-7
atypical teratoid / rhabdoid tumor 4369 1.23276255214E-6
osteosarcoma 7933 2.48609700618724E-5
ovarian cancer 8492 3.78657480980874E-5
adult high grade glioma 2148 8.87174472707954E-5
glioblastoma 5572 9.56986956960455E-5
adrenocortical carcinoma 1427 1.93062634195674E-4
Multiple myeloma 1328 4.88955231230915E-4
medulloblastoma, large-cell 6234 9.50489566054603E-4
pilocytic astrocytoma 3086 0.00121418824281794
group 4 medulloblastoma 1875 0.00146351665613073
dermatomyositis 967 0.00266194940567012
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00298319935741324
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00683889535418312
pancreatic cancer 2300 0.00990492979122861
lung cancer 4473 0.0131052897143679
astrocytic glioma 2241 0.0143461800626021
oligodendroglioma 2849 0.0171871605749149
ependymoma 2514 0.0189244561330379
Breast cancer 3099 0.0382297880111965
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 2.0
Disease Target Count Z-score Confidence
Phlebotomus fever 6 3.323 1.7
Endometritis 21 3.056 1.5

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.859 0.000
astrocytic glioma -2.400 0.014
ependymoma -2.800 0.019
oligodendroglioma -2.400 0.017
osteosarcoma -1.993 0.000
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
group 4 medulloblastoma -1.300 0.001
medulloblastoma, large-cell -1.900 0.001
autosomal dominant Emery-Dreifuss muscul... 1.071 0.003
juvenile dermatomyositis 1.401 0.000
acute quadriplegic myopathy 1.758 0.000
adrenocortical carcinoma -1.583 0.000
pancreatic ductal adenocarcinoma liver m... -1.557 0.007
lung cancer 1.100 0.013
Breast cancer 2.700 0.038
adult high grade glioma -1.700 0.000
pilocytic astrocytoma -1.200 0.001
psoriasis 1.200 0.000
ovarian cancer -1.600 0.000
pancreatic cancer 1.200 0.010
dermatomyositis 1.300 0.003

Synonym

Accession Q7L1Q6 B4DLZ8 B4DWF7 Q14281 Q15394 Q9BUY0
Symbols BZAP45
Nbla10236

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA EggNOG Inparanoid
Fruitfly OMA EggNOG

Gene RIF (3)

PMID Text
21734401 Data indicate taht candidate genes ACTB, BZW, OCM, MACC1, NXPH1, PRPS1L1, RAC1 and RPA3, which lie within the DFNB90 region, were sequenced and no potentially causal variants were identified.
19446954 BZW1 is a novel factor, promoting the growth of MEC cells
11524015 Stimulates cell cycle regulation of histone H4 gene transcription.

AA Sequence

MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETL      1 - 70
FDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLK     71 - 140
GFSESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVS    141 - 210
MDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKE    211 - 280
EMKKNNIPEPVVIGIVWSSVMSTVEWNKKEELVAEQAIKHLKQYSPLLAAFTTQGQSELTLLLKIQEYCY    281 - 350
DNIHFMKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD     351 - 419
//

Text Mined References (30)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21734401 2011 Novel autosomal recessive nonsyndromic hearing impairment locus DFNB90 maps to 7p22.1-p15.3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...