Property Summary

NCBI Gene PubMed Count 20
PubMed Score 26.05
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.758 2.1e-07
adrenocortical carcinoma -1.583 1.9e-04
adult high grade glioma -1.700 8.9e-05
astrocytic glioma -2.400 1.4e-02
Astrocytoma, Pilocytic -1.200 1.1e-03
atypical teratoid / rhabdoid tumor -2.000 1.2e-06
autosomal dominant Emery-Dreifuss muscul... 1.071 3.0e-03
Breast cancer 2.700 3.8e-02
dermatomyositis 1.300 2.7e-03
ependymoma -2.800 1.9e-02
glioblastoma -1.200 1.7e-05
group 4 medulloblastoma -1.300 1.5e-03
juvenile dermatomyositis 1.401 3.3e-12
lung cancer 1.100 1.3e-02
medulloblastoma, large-cell -1.900 9.5e-04
Multiple myeloma 1.859 4.9e-04
oligodendroglioma -2.400 1.7e-02
osteosarcoma 1.359 3.7e-04
ovarian cancer -1.600 3.8e-05
pancreatic cancer 1.200 9.9e-03
pancreatic ductal adenocarcinoma liver m... -1.557 6.8e-03
psoriasis 1.100 1.9e-06

Gene RIF (3)

AA Sequence

MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETL      1 - 70
FDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLK     71 - 140
GFSESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVS    141 - 210
MDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKE    211 - 280
EMKKNNIPEPVVIGIVWSSVMSTVEWNKKEELVAEQAIKHLKQYSPLLAAFTTQGQSELTLLLKIQEYCY    281 - 350
DNIHFMKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD     351 - 419
//

Text Mined References (31)

PMID Year Title