Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.45
PubTator Score 10.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -4.100 9.6e-07
astrocytic glioma -4.000 1.1e-03
Astrocytoma, Pilocytic -5.600 1.4e-14
atypical teratoid / rhabdoid tumor -5.600 1.9e-14
breast carcinoma -1.400 1.3e-03
ductal carcinoma in situ -1.500 1.5e-03
ependymoma -5.300 5.5e-04
fibroadenoma -1.800 1.1e-02
glioblastoma -4.500 8.1e-11
group 3 medulloblastoma -1.900 4.8e-03
intraductal papillary-mucinous adenoma (... -3.300 2.8e-05
intraductal papillary-mucinous carcinoma... -3.400 3.6e-05
intraductal papillary-mucinous neoplasm ... -3.200 1.4e-03
invasive ductal carcinoma -1.500 9.5e-03
lung carcinoma 2.500 7.2e-12
medulloblastoma, large-cell -2.900 3.6e-04
oligodendroglioma -3.500 7.0e-03
osteosarcoma -2.577 2.1e-05
pancreatic cancer -1.200 7.3e-03
Pick disease -2.100 3.1e-02
pituitary cancer 1.100 4.9e-02
primitive neuroectodermal tumor -4.600 1.6e-05
subependymal giant cell astrocytoma -4.140 2.0e-02

Gene RIF (7)

AA Sequence

MDDYKYQDNYGGYAPSDGYYRGNESNPEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDVKAKQAKMAPSR      1 - 70
MDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGRFQWILFFVLGLALMADGVEVFVVSFALPSAEKDM     71 - 140
CLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRKRVLSMSLAVNASFASLSSFVQGYGAFLFCRLISGI    141 - 210
GIGGALPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGLYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFV    211 - 280
IVCALPCTVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSNIKTPKQMDEFI    281 - 350
EIQSSTGTWYQRWLVRFKTIFKQVWDNALYCVMGPYRMNTLILAVVWFAMAFSYYGLTVWFPDMIRYFQD    351 - 420
EEYKSKMKVFFGEHVYGATINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFEDVTSTDTYFK    421 - 490
NCTIESTIFYNTDLYEHKFINCRFINSTFLEQKEGCHMDLEQDNDFLIYLVSFLGSLSVLPGNIISALLM    491 - 560
DRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGIL    561 - 630
NGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM                     631 - 683
//

Text Mined References (22)

PMID Year Title