Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.25
PubTator Score 5.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 0.0283300008025953

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 2.800 0.028

Synonym

Accession Q7L0Y3 Q9NRG5 Q9NX54 Q9Y596 Mitochondrial RNase P protein 1
Symbols HNYA
MRPP1
COXPD30
RG9MTD1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly OMA Inparanoid

Gene RIF (4)

PMID Text
23755257 Inhibition of mitochondrial RNase P by beta-amyloid is an unspecific effect and is not mediated by beta-amyloid interaction with SDR5C1.
22028365 We also identify the 5' and 3' transcript ends of the three lncRNAs and show that mitochondrial RNase P protein 1 (MRPP1) is important for the processing of these transcripts.
21857155 MRPP1 is essential for transcript processing, RNA modification, translation and mitochondrial respiration.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAFLKMSVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTM      1 - 70
KSSVQEECVSTISSSKDEDPLAATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKE     71 - 140
KVKKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMGWKGAQAMQFGQPLVFDMA    141 - 210
YENYMKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQEKWDKLLLTSTEKSHVD    211 - 280
LFPKDSIIYLTADSPNVMTTFRHDKVYVIGSFVDKSMQPGTSLAKAKRLNLATECLPLDKYLQWEIGNKN    281 - 350
LTLDQMIRILLCLKNNGNWQEALQFVPKRKHTGFLEISQHSQEFINRLKKAKT                     351 - 403
//

Text Mined References (22)

PMID Year Title
27132592 2016 Recessive Mutations in TRMT10C Cause Defects in Mitochondrial RNA Processing and Multiple Respiratory Chain Deficiencies.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23755257 2013 The amyloid-?-SDR5C1(ABAD) interaction does not mediate a specific inhibition of mitochondrial RNase P.
23473034 2013 GRSF1 regulates RNA processing in mitochondrial RNA granules.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23042678 2012 A subcomplex of human mitochondrial RNase P is a bifunctional methyltransferase--extensive moonlighting in mitochondrial tRNA biogenesis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22028365 2011 Long noncoding RNAs are generated from the mitochondrial genome and regulated by nuclear-encoded proteins.
21857155 2011 RNA processing in human mitochondria.
More...