Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.23
PubTator Score 5.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 30 1 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 2.800 2.8e-02

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MAAFLKMSVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTM      1 - 70
KSSVQEECVSTISSSKDEDPLAATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKE     71 - 140
KVKKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMGWKGAQAMQFGQPLVFDMA    141 - 210
YENYMKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQEKWDKLLLTSTEKSHVD    211 - 280
LFPKDSIIYLTADSPNVMTTFRHDKVYVIGSFVDKSMQPGTSLAKAKRLNLATECLPLDKYLQWEIGNKN    281 - 350
LTLDQMIRILLCLKNNGNWQEALQFVPKRKHTGFLEISQHSQEFINRLKKAKT                     351 - 403
//

Text Mined References (25)

PMID Year Title