Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.25
PubTator Score 5.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Breast cancer 3,094

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 2.800 0.028

Synonym

Accession Q7L0Y3 Q9NRG5 Q9NX54 Q9Y596 Mitochondrial RNase P protein 1
Symbols HNYA
MRPP1
COXPD30
RG9MTD1

Gene

Gene RIF (4)

PMID Text
23755257 Inhibition of mitochondrial RNase P by beta-amyloid is an unspecific effect and is not mediated by beta-amyloid interaction with SDR5C1.
22028365 We also identify the 5' and 3' transcript ends of the three lncRNAs and show that mitochondrial RNase P protein 1 (MRPP1) is important for the processing of these transcripts.
21857155 MRPP1 is essential for transcript processing, RNA modification, translation and mitochondrial respiration.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAFLKMSVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTM      1 - 70
KSSVQEECVSTISSSKDEDPLAATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKE     71 - 140
KVKKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMGWKGAQAMQFGQPLVFDMA    141 - 210
YENYMKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQEKWDKLLLTSTEKSHVD    211 - 280
LFPKDSIIYLTADSPNVMTTFRHDKVYVIGSFVDKSMQPGTSLAKAKRLNLATECLPLDKYLQWEIGNKN    281 - 350
LTLDQMIRILLCLKNNGNWQEALQFVPKRKHTGFLEISQHSQEFINRLKKAKT                     351 - 403
//

Text Mined References (22)

PMID Year Title
27132592 2016 Recessive Mutations in TRMT10C Cause Defects in Mitochondrial RNA Processing and Multiple Respiratory Chain Deficiencies.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23755257 2013 The amyloid-?-SDR5C1(ABAD) interaction does not mediate a specific inhibition of mitochondrial RNase P.
23473034 2013 GRSF1 regulates RNA processing in mitochondrial RNA granules.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23042678 2012 A subcomplex of human mitochondrial RNase P is a bifunctional methyltransferase--extensive moonlighting in mitochondrial tRNA biogenesis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22028365 2011 Long noncoding RNAs are generated from the mitochondrial genome and regulated by nuclear-encoded proteins.
21857155 2011 RNA processing in human mitochondria.
More...