Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 12.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -3.200 1.2e-06
Down syndrome 1.400 4.2e-03
glioblastoma -1.600 6.1e-03
group 3 medulloblastoma -3.000 3.3e-05
lung cancer -1.900 2.1e-03
medulloblastoma, large-cell -1.900 1.0e-02
ovarian cancer -1.400 2.3e-05
pituitary cancer 1.100 4.7e-03
posterior fossa group B ependymoma 1.600 5.1e-07
subependymal giant cell astrocytoma -3.785 1.5e-03

Gene RIF (2)

AA Sequence

MEAARALRLLLVVCGCLALPPLAEPVCPERCDCQHPQHLLCTNRGLRVVPKTSSLPSPHDVLTYSLGGNF      1 - 70
ITNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQALAPGTLAPLRKLRILYANG     71 - 140
NEISRLSRGSFEGLESLVKLRLDGNALGALPDAVFAPLGNLLYLHLESNRIRFLGKNAFAQLGKLRFLNL    141 - 210
SANELQPSLRHAATFAPLRSLSSLILSANNLQHLGPRIFQHLPRLGLLSLRGNQLTHLAPEAFWGLEALR    211 - 280
ELRLEGNRLSQLPTALLEPLHSLEALDLSGNELSALHPATFGHLGRLRELSLRNNALSALSGDIFAASPA    281 - 350
LYRLDLDGNGWTCDCRLRGLKRWMGDWHSQGRLLTVFVQCRHPPALRGKYLDYLDDQQLQNGSCADPSPS    351 - 420
ASLTADRRRQPLPTAAGEEMTPPAGLAEELPPQPQLQQQGRFLAGVAWDGAARELVGNRSALRLSRRGPG    421 - 490
LQQPSPSVAAAAGPAPQSLDLHKKPQRGRPTRADPALAEPTPTASPGSAPSPAGDPWQRATKHRLGTEHQ    491 - 560
ERAAQSDGGAGLPPLVSDPCDFNKFILCNLTVEAVGADSASVRWAVREHRSPRPLGGARFRLLFDRFGQQ    561 - 630
PKFHRFVYLPESSDSATLRELRGDTPYLVCVEGVLGGRVCPVAPRDHCAGLVTLPEAGSRGGVDYQLLTL    631 - 700
ALLTVNALLVLLALAAWASRWLRRKLRARRKGGAPVHVRHMYSTRRPLRSMGTGVSADFSGFQSHRPRTT    701 - 770
VCALSEADLIEFPCDRFMDSAGGGAGGSLRREDRLLQRFAD                                 771 - 811
//

Text Mined References (10)

PMID Year Title