Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.30

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 3.4e-06
Multiple myeloma 1.221 1.3e-03
ovarian cancer -1.100 4.1e-04
pancreatic ductal adenocarcinoma liver m... 1.058 1.7e-02
psoriasis 1.400 4.3e-04

Synonym

Accession Q7L0R7 B4DYE0 Q8ND05 Q9UPQ2
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MRPWALAVTRWPPSAPVGQRRFSAGPGSTPGQLWGSPGLEGPLASPPARDERLPSQQPPSRPPHLPVEER      1 - 70
RASAPAGGSPRMLHPATQQSPFMVDLHEQVHQGPVPLSYTVTTVTTQGFPLPTGQHIPGCSAQQLPACSV     71 - 140
MFSGQHYPLCCLPPPLIQACTMQQLPVPYQAYPHLISSDHYILHPPPPAPPPQPTHMAPLGQFVSLQTQH    141 - 210
PRMPLQRLDNDVDLRGDQPSLGSFTYSTSAPGPALSPSVPLHYLPHDPLHQELSFGVPYSHMMPRRLSTQ    211 - 280
RYRLQQPLPPPPPPPPPPPYYPSFLPYFLSMLPMSPTAMGPTISLDLDVDDVEMENYEALLNLAERLGDA    281 - 350
KPRGLTKADIEQLPSYRFNPDSHQSEQTLCVVCFSDFEARQLLRVLPCNHEFHTKCVDKWLKANRTCPIC    351 - 420
RADASEVPREAE                                                              421 - 432
//

Text Mined References (9)

PMID Year Title