Property Summary

NCBI Gene PubMed Count 30
Grant Count 10
R01 Count 10
Funding $295,793.66
PubMed Score 23.77
PubTator Score 20.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
26598620 PAK4 and RhoU cooperate to drive adhesion turnover and promote cell migration.
23811937 Data indicate that upregulated miR-126 upon coxsackievirus B3 (CVB3) infection targets SPRED1, LRP6, and WRCH1 genes, mediating cross-talk between ERK1/2 and Wnt/beta-catenin pathways, and thus promoting viral replication.
23333304 HIV-1 Vif downregulates the expression of ras homolog family member U (RHOU) in Vif-expression T cells
23183748 multiple upstream signals may converge on Wrch1 directly through its SH3 domain-binding properties
22349824 results indicate that NOTCH1 mutation stimulates T-cell acute lymphoblastic leukaemia cell migration through RhoU upregulation that could contribute to the leukaemia cell dissemination
21565175 A screen for Wrch-1 binding-partners identified the novel RhoGAP protein, ARHGAP30, as a Wrch-1 interactor.
21508312 data suggest a unique regulatory mechanism by which RhoU interaction with SH3 adaptor proteins might serve to integrate growth factor receptor signaling with RhoU activatio
20547754 Studies revealed a requirement for serum-stimulated tyrosine phosphorylation of Wrch1 at residue Y254 within its C-terminal membrane targeting domain, mediated by the nonreceptor tyrosine kinase Src.
19135548 As an essential actor of osteoclast differentiation, the atypical RhoGTPase Wrch1/RhoU could be an interesting target for the development of novel antiresorptive drugs.
19064640 Wrch-1-induced morphological and growth transformation may occur in part through Par6-mediated disruption of tight junction and actin organization.
More...

AA Sequence

MPPQQGDPAFPDRCEAPPVPPRRERGGRGGRGPGEPGGRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYT      1 - 70
TNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVS     71 - 140
EKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEIKAASYIECSALTQKN    141 - 210
LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV                          211 - 258
//

Text Mined References (35)

PMID Year Title
26598620 2015 PAK4 promotes kinase-independent stabilization of RhoU to modulate cell adhesion.
24403052 2014 Germline sequence variants in TGM3 and RGS22 confer risk of basal cell carcinoma.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23811937 2013 MiR-126 promotes coxsackievirus replication by mediating cross-talk of ERK1/2 and Wnt/?-catenin signal pathways.
23300278 2013 Genome-wide association study identifies a novel locus contributing to type 2 diabetes susceptibility in Sikhs of Punjabi origin from India.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
23183748 2013 SH3-mediated targeting of Wrch1/RhoU by multiple adaptor proteins.
22773346 2013 Linkage and association of successful aging to the 6q25 region in large Amish kindreds.
22349824 2013 Analysis of Rho GTPase expression in T-ALL identifies RhoU as a target for Notch involved in T-ALL cell migration.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
More...