Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

AA Sequence

MKGLRVAKAFQPSQGCSRQALGHLSGRGPSPRSEMNSSVGDLGVGGCSLWDDPARFIVVPAAYALALGLG      1 - 70
LPANVAALAMFIRSGGRLGQALLLYLFNLALVDEFFTLTLQLWLTYYLGLARRPPATRPGPPTTCPPMRR     71 - 140
WSSPRSSACAAAASYAVPGPGRLPAWPGAYGAPRALPAPSPGWRAWPLPAWSTAGQARGWPPPRWPSRPP    141 - 210
SCWCSRPT                                                                  211 - 218
//

Text Mined References (1)

PMID Year Title