Property Summary

Ligand Count 4
NCBI Gene PubMed Count 39
PubMed Score 395.15
PubTator Score 208.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.700 5.4e-06
astrocytoma -1.200 3.1e-19
atypical teratoid / rhabdoid tumor -2.300 3.8e-07
ependymoma -2.600 2.2e-20
Gaucher disease type 1 1.100 2.3e-02
glioblastoma -1.300 3.1e-06
group 3 medulloblastoma -2.200 1.1e-06
lung cancer 2.400 7.0e-04
lung carcinoma 3.500 1.4e-52
malignant mesothelioma 5.100 1.5e-07
medulloblastoma, large-cell -1.600 6.5e-03
non-small cell lung cancer 1.073 6.8e-09
ovarian cancer 1.300 1.6e-07

Gene RIF (17)

AA Sequence

MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPAPSDGYYRGEG      1 - 70
TQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQ     71 - 140
RRKEREELAQQYEAILRECGHGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLI    141 - 210
VYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYF    211 - 280
SEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGA    281 - 350
LTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW    351 - 420
GVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDYASRTKVFPGE    421 - 490
RVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTD    491 - 560
LFEYKFVNSRLINSTFLHNKEGCPLDVTGTGEGAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAG    561 - 630
SSVMSCVSCFFLSFGNSESAMIALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLG    631 - 700
ISIFTSFVGITKAAPILFASAALALGSSLALKLPETRGQVLQ                                701 - 742
//

Text Mined References (41)

PMID Year Title