Property Summary

NCBI Gene PubMed Count 39
Grant Count 70
R01 Count 47
Funding $9,555,096.79
PubMed Score 377.28
PubTator Score 208.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 5.100 0.000
astrocytoma -1.200 0.000
glioblastoma -1.500 0.000
posterior fossa group B ependymoma -2.800 0.000
sonic hedgehog group medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -1.600 0.007
non-small cell lung cancer 1.073 0.000
lung cancer 2.400 0.001
adult high grade glioma -1.700 0.000
lung carcinoma 3.500 0.000
ovarian cancer 1.300 0.000
Gaucher disease type 1 1.100 0.023

Synonym

Accession Q7L0J3 D3DUZ7 O94841 Q5QNX8 Q7Z3L6 Q8NBJ6 Q9BVZ9
Symbols SV2

Gene

PDB

4V11  

Gene RIF (17)

PMID Text
26339411 Botulinum neurotoxin type A inhibits synaptic vesicle 2 expression in breast cancer cell lines.
26241848 SV2A expression in the bladder urothelium increases after BoNT-A injection.
25692762 the way LEV analogues may interact with SV2A
25326386 The newly identified galactose transport capability of SV2A may have an important role in regulating/modulating synaptic function.
24284412 The SV2A/FE65 interaction might play a role in synaptic signal transduction.
23617838 In classical mesial temporal sclerosis 1A, the expression of SV2 isoforms is altered with a marked decrease of SV2A paralleling synaptic loss.
23530581 agents that act on the conformation of SV2A might hold great potential in the search for new SV2A-based anticonvulsant therapies
23244111 High SV2A expression is associated with breast cancer.
23017826 This study in the German population provides evidence, at a genetic level, for the involvement of the SV2A gene region in schizophrenia.
21936812 Data report a combined modelling and mutagenesis study that successfully identifies another 11 residues in synaptic vesicle protein 2A that appear to be involved in ligand binding.
More...

AA Sequence

MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPAPSDGYYRGEG      1 - 70
TQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQ     71 - 140
RRKEREELAQQYEAILRECGHGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLI    141 - 210
VYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYF    211 - 280
SEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGA    281 - 350
LTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW    351 - 420
GVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDYASRTKVFPGE    421 - 490
RVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTD    491 - 560
LFEYKFVNSRLINSTFLHNKEGCPLDVTGTGEGAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAG    561 - 630
SSVMSCVSCFFLSFGNSESAMIALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLG    631 - 700
ISIFTSFVGITKAAPILFASAALALGSSLALKLPETRGQVLQ                                701 - 742
//

Text Mined References (41)

PMID Year Title
26639968 2016 A Mitochondrial Role of SV2a Protein in Aging and Alzheimer's Disease: Studies with Levetiracetam.
26339411 2015 Botulinum neurotoxin type A inhibits synaptic vesicle 2 expression in breast cancer cell lines.
26241848 2015 Presence of Cleaved Synaptosomal-Associated Protein-25 and Decrease of Purinergic Receptors P2X3 in the Bladder Urothelium Influence Efficacy of Botulinum Toxin Treatment for Overactive Bladder Syndrome.
25692762 2015 Exploring the interaction of SV2A with racetams using homology modelling, molecular dynamics and site-directed mutagenesis.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25326386 2014 The human synaptic vesicle protein, SV2A, functions as a galactose transporter in Saccharomyces cerevisiae.
24284412 2014 Amyloid beta a4 precursor protein-binding family B member 1 (FE65) interactomics revealed synaptic vesicle glycoprotein 2A (SV2A) and sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) as new binding proteins in the human brain.
23617838 2014 Expression pattern of synaptic vesicle protein 2 (SV2) isoforms in patients with temporal lobe epilepsy and hippocampal sclerosis.
23530581 2013 Modulation of the conformational state of the SV2A protein by an allosteric mechanism as evidenced by ligand binding assays.
23244111 2012 Synaptic vesicle protein 2 (SV2) isoforms.
More...