Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.69
PubTator Score 3.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.613 1.8e-06
adult high grade glioma -1.200 2.0e-04
atypical teratoid / rhabdoid tumor -3.100 3.1e-04
dermatomyositis 1.100 4.8e-03
ependymoma -1.500 2.0e-07
glioblastoma -1.900 8.0e-03
intraductal papillary-mucinous adenoma (... 1.300 8.0e-03
invasive ductal carcinoma -1.100 6.6e-03
juvenile dermatomyositis 1.288 1.9e-09
malignant mesothelioma -1.200 1.1e-05
medulloblastoma, large-cell -2.000 2.8e-04
non-small cell lung cancer -1.493 6.8e-15
ovarian cancer -1.500 2.8e-05
pancreatic ductal adenocarcinoma liver m... 1.508 9.5e-04
psoriasis -1.100 5.2e-03
Rheumatoid arthritis 1.100 3.5e-02
subependymal giant cell astrocytoma 1.779 4.3e-03

Gene RIF (2)

AA Sequence

MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERM      1 - 70
NLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLV     71 - 140
PEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEPNALMMEEEGAIIAG    141 - 210
LLVGLNVIDANFCMKGEDLDSQVGVIDFSMYLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNN    211 - 280
LQAKVDALEKSNTKLTEELAVANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLK    281 - 350
EETQLRLDVEKELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK    351 - 420
QKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQAKTLNSAANKLIPKHH                         421 - 469
//

Text Mined References (11)

PMID Year Title