Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.23
PubTator Score 3.81

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7L099 B3KM25 B4DYW7 D9N163 O94948 Q9UI00
Symbols RIPX
SINGAR1
ZFYVE30

Gene

Gene RIF (2)

PMID Text
25766321 these findings provide important evidence that PAK1 can positively regulate RUFY3 expression, which contribute to the metastatic potential of gastric cancer cells
20376209 Rab5(Q79L) interacts with the carboxyl terminus of RUFY3

AA Sequence

MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERM      1 - 70
NLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLV     71 - 140
PEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEPNALMMEEEGAIIAG    141 - 210
LLVGLNVIDANFCMKGEDLDSQVGVIDFSMYLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNN    211 - 280
LQAKVDALEKSNTKLTEELAVANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLK    281 - 350
EETQLRLDVEKELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK    351 - 420
QKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQAKTLNSAANKLIPKHH                         421 - 469
//

Text Mined References (11)

PMID Year Title
25766321 2015 PAK1 regulates RUFY3-mediated gastric cancer cell migration and invasion.
21269460 2011 Initial characterization of the human central proteome.
20376209 2010 Rab5(Q79L) interacts with the carboxyl terminus of RUFY3.
17439943 2007 Singar1, a novel RUN domain-containing protein, suppresses formation of surplus axons for neuronal polarity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...