Property Summary

NCBI Gene PubMed Count 16
PubMed Score 22.98
PubTator Score 12.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
osteosarcoma 7950 2.8e-07
atypical teratoid / rhabdoid tumor 5112 1.1e-05
ovarian cancer 8520 1.3e-05
Pick disease 1894 1.6e-05
psoriasis 6694 4.6e-04
lung cancer 4740 1.1e-03
medulloblastoma, large-cell 6241 5.7e-03
Disease Target Count Z-score Confidence
cytochrome-c oxidase deficiency disease 19 0.0 5.0
Disease Target Count Z-score Confidence
Hypertrophic Cardiomyopathy 117 3.839 1.9

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.1e-05
lung cancer 1.300 1.1e-03
medulloblastoma, large-cell 1.100 5.7e-03
osteosarcoma -2.099 2.8e-07
ovarian cancer -1.100 1.3e-05
Pick disease 1.400 1.6e-05
psoriasis -2.000 4.6e-04

 GWAS Trait (1)

Gene RIF (8)

AA Sequence

MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGRGTVSLPSKAAERVVG      1 - 70
RWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLT     71 - 140
EFKFIWYMEYSHRMWGRLVGLVYILPAAYFWRKGWLSRGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKS    141 - 210
DSHDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPPHKLPETHQLLQLRRFAHGTAGLVFLTALSGAF    211 - 280
VAGLDAGLVYNSFPKMGESWIPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIPLP    281 - 350
RRTKMAAVTLLALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLTGALWLMNELRRVPK              351 - 410
//

Text Mined References (22)

PMID Year Title