Property Summary

NCBI Gene PubMed Count 67
Grant Count 121
R01 Count 94
Funding $15,857,808.72
PubMed Score 259.64
PubTator Score 171.11

Knowledge Summary

Patent (46,648)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma 1.230 0.000
adult high grade glioma -1.200 0.006

Synonym

Accession Q7KZI7 Q15449 Q15524 Q5XGA3 Q68A18 Q96HB3 Q96RG0
Symbols EMK1
EMK-1
PAR-1
Par1b
Par-1b

Gene

PDB

3IEC   5EAK  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (26)

PMID Text
25907283 MARK2 plays a role in promoting malignant phenotypes of lung cancer.
24358023 induces asymmetric inheritance of plasma membrane domains via LGN-dependent mitotic spindle orientation in proliferating hepatocytes
24354359 Perturbation of PAR1b and SHP2 by CagA underlies the oncogenic potential of CagA.
24259665 Phosphorylation of RNF41 by Par-1b regulates basolateral membrane targeting of laminin-111 receptors.
24251416 The MARK2 binds to the N-terminal tail of Tau and selectively phosphorylates three major and five minor serine residues in the repeat domain and C-terminal tail.
24165937 Hepatocyte Par1b defines lumen position in concert with the position of the astral microtubule anchoring complex LGN-NuMA to yield the distinct epithelial division phenotypes.
22883624 The scaffolding adaptor GAB1 interacts with two polarity proteins, PAR1 and PAR3.
22848487 automated image analysis of MT assembly dynamics identified MARK2 as a target regulated downstream of Rac1 that promotes oriented MT growth in the leading edge to mediate directed cell migration.
22238344 The results identify MARK2 as an upstream regulator of PINK1 and DeltaN-PINK1 and provide insights into the regulation of mitochondrial trafficking in neurons and neurodegeneration in PD.
22072711 Polarity-regulating kinase partitioning-defective 1b (PAR1b) phosphorylates guanine nucleotide exchange factor H1 (GEF-H1) to regulate RhoA-dependent actin cytoskeletal reorganization.
More...

AA Sequence

MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLA      1 - 70
RHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDY     71 - 140
LVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFC    141 - 210
GSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENL    211 - 280
LKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQR    281 - 350
YNEVMATYLLLGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTS    351 - 420
NSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLE    421 - 490
RASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMSASVHPNKASGLPPTESNCEVPRPST    491 - 560
APQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAGQLRQVRDQQNLPYGVTPASPSGHSQGRRGA    561 - 630
SGSIFSKFTSKFVRRNLSFRFARRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMK    631 - 700
TTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISG    701 - 770
TSMAFKNIASKIANELKL                                                        771 - 788
//

Text Mined References (84)

PMID Year Title
25907283 2015 Microtubule affinity-regulating kinase 2 is associated with DNA damage response and cisplatin resistance in non-small cell lung cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24522549 2014 Oxidative stress-induced signaling pathways implicated in the pathogenesis of Parkinson's disease.
24358023 2013 Par1b induces asymmetric inheritance of plasma membrane domains via LGN-dependent mitotic spindle orientation in proliferating hepatocytes.
24354359 2014 Natural variant of the Helicobacter pylori CagA oncoprotein that lost the ability to interact with PAR1.
24259665 2014 Phosphorylation of the E3 ubiquitin ligase RNF41 by the kinase Par-1b is required for epithelial cell polarity.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24251416 2013 Phosphorylation of human Tau protein by microtubule affinity-regulating kinase 2.
24165937 2013 Par1b links lumen polarity with LGN-NuMA positioning for distinct epithelial cell division phenotypes.
23902687 2013 The novel PAR-1-binding protein MTCL1 has crucial roles in organizing microtubules in polarizing epithelial cells.
More...