Property Summary

Ligand Count 2
NCBI Gene PubMed Count 70
PubMed Score 272.34
PubTator Score 171.11

Knowledge Summary

Patent (46,648)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Adenoid Cystic 99 0.0 0.0
Salivary Gland Neoplasms 46 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 6.0e-05
osteosarcoma 7950 4.3e-04
adult high grade glioma 3801 6.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.437 1.7
Asthenopia 10 3.257 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.200 6.1e-03
malignant mesothelioma 1.100 6.0e-05
osteosarcoma 1.230 4.3e-04

Gene RIF (28)

AA Sequence

MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLA      1 - 70
RHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDY     71 - 140
LVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFC    141 - 210
GSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENL    211 - 280
LKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQR    281 - 350
YNEVMATYLLLGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTS    351 - 420
NSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLE    421 - 490
RASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMSASVHPNKASGLPPTESNCEVPRPST    491 - 560
APQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAGQLRQVRDQQNLPYGVTPASPSGHSQGRRGA    561 - 630
SGSIFSKFTSKFVRRNLSFRFARRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMK    631 - 700
TTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISG    701 - 770
TSMAFKNIASKIANELKL                                                        771 - 788
//

Text Mined References (86)

PMID Year Title