Property Summary

NCBI Gene PubMed Count 62
Grant Count 18
R01 Count 15
Funding $3,709,982.2
PubMed Score 205.31
PubTator Score 51.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.100 0.002
astrocytoma 1.500 0.001
medulloblastoma, large-cell 1.100 0.000
acute quadriplegic myopathy 1.044 0.000
primary pancreatic ductal adenocarcinoma -1.481 0.000
pancreatic cancer -1.500 0.001

Gene RIF (39)

PMID Text
26997225 This study unravels a novel mechanism of SND1 function and identifies MGLL as a unique tumor suppressor for HCC. MGLL might function as a homeostatic regulator of Akt restraining its activation.
26323317 SND1 is a determinant downstream effector of TNFalpha that contributes to support glycerophospholipid homeostasis in human hepatocellular carcinoma during inflammation.
25985019 we identified a new SND1-BRAF fusion that appeared to be present in a subpopulation of tumor cells.
25965817 it could be concluded that miR-361-5p functions as a tumor-suppressive miRNA through directly binding to SND1
25663449 Single nucleotide polymorphism in SND1 gene is associated with osteosarcoma susceptibility.
25627688 Tudor-SN is a potential substrate of G1/S phase Cyclin-Dependent Kinases, and promotes cell cycle progression by facilitating E2F-1-mediated gene transcription.
25596283 SND1 promoted expression of the E3 ubiquitin ligase Smurf1, leading to RhoA ubiquitination and degradation.
25559396 Tudor-SN regulates the aggregation dynamics of poly(A(+) mRNA-containing stress granules and selectively stabilizes the stress granules-associated mRNA during cellular stress.
25494629 Promoter activity of the cell growth- and RNA-protection associated SND1 gene is up-regulated by ER stress in human hepatoma cells
25405367 we describe the crucial role of SND1 in cancer development and progression, and highlight SND1 as a potential target for therapeutic intervention.
More...

AA Sequence

MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDA      1 - 70
KDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNGENIAESLVAEGLATRREGMR     71 - 140
ANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRA    141 - 210
LLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHP    211 - 280
NGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQV    281 - 350
LNADAIVVKLNSGDYKTIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVD    351 - 420
YIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNG    421 - 490
KGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIEC    491 - 560
PRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSKV    561 - 630
HFTAERSSYYKSLLSAEEAAKQKKEKVWAHYEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQD    631 - 700
VETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNRE    701 - 770
VLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHV    771 - 840
TLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDADEFGYSR    841 - 910
//

Publication (73)

PMID Year Title
26997225 2016 Staphylococcal Nuclease and Tudor Domain Containing 1 (SND1 Protein) Promotes Hepatocarcinogenesis by Inhibiting Monoglyceride Lipase (MGLL).
26323317 2015 Profiling of promoter occupancy by the SND1 transcriptional coactivator identifies downstream glycerolipid metabolic genes involved in TNF? response in human hepatoma cells.
25985019 2015 Common Oncogene Mutations and Novel SND1-BRAF Transcript Fusion in Lung Adenocarcinoma from Never Smokers.
25965817 2015 MiR-361-5p inhibits colorectal and gastric cancer growth and metastasis by targeting staphylococcal nuclease domain containing-1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25663449 2015 Polymorphisms in miRNA processing genes and their role in osteosarcoma risk.
25627688 2015 Tudor staphylococcal nuclease (Tudor-SN), a novel regulator facilitating G1/S phase transition, acting as a co-activator of E2F-1 in cell cycle regulation.
25596283 2015 SND1 Acts Downstream of TGF?1 and Upstream of Smurf1 to Promote Breast Cancer Metastasis.
25559396 2015 Poly(A)(+) mRNA-binding protein Tudor-SN regulates stress granules aggregation dynamics.
25494629 2014 The promoter of cell growth- and RNA protection-associated SND1 gene is activated by endoplasmic reticulum stress in human hepatoma cells.
More...