Property Summary

NCBI Gene PubMed Count 25
PubMed Score 61.00
PubTator Score 24.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.01357297549911E-7
glioblastoma 5572 9.59591320896555E-6
medulloblastoma, large-cell 6234 3.61068796224438E-5
osteosarcoma 7933 5.52848964376919E-4
astrocytoma 1493 0.0124375986521531
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Chromosome 17q11.2 deletion syndrome, 1.4Mb 14 3.423 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.388 0.001
astrocytoma 1.100 0.012
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.100 0.000
medulloblastoma, large-cell 1.300 0.000

Synonym

Accession Q7KZ85 A7E2B4 Q15737 Q6GMQ4 Q7KYW9 Q7LDK4 Q8N526 Q92775 Q96AH3 Q9BTH9 Q9BTI2 hSPT6
Symbols SPT6
SPT6H
emb-5

Gene

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GO Component (1)

 MGI Term (1)

Gene RIF (8)

PMID Text
25590759 Altogether, these results indicate that a complex containing LEDGF/p75, Iws1, and Spt6 participates in regulating postintegration steps of HIV latency.
25590759 Knockdown of SPT6 by shRNA enhances HIV-1 replication in HIV-1-infected CD4+ T-cells and latently infected cells
24441044 identified fibronectin, a component of the extracellular matrix and a mesenchymal marker, as a transcriptional target of Pak1 signaling
22843687 Spt6 is a unique histone chaperone capable of regulating the histone epigenetic state of both AID targets and the AID locus.
22316138 These results show that intracellular levels of Spt6 are fine-tuned by PAAF1 and proteasome, which is required for HIV-1 transcription and extends to cellular genes implicated in cancer.
22171252 Abolishing UL69's ability to interact with the SPT6 protein inhibited human cytomegalovirus replication.
21518874 Knockdown of Spt6 resulted in severe reduction of class switch recombination in the endogenous Ig locus in B cells.
15060154 Reults establish that human Spt6 (hSpt6) is a classic transcription elongation factor that enhances the rate of RNA polymerase II elongation.

AA Sequence

MSDFVESEAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGNLKGFINDDDDEDEGEED      1 - 70
EGSDSGDSEDDVGHKKRKRTSFDDRLEDDDFDLIEENLGVKVKRGQKYRRVKKMSDDEDDDEEEYGKEEH     71 - 140
EKEAIAEEIFQDGEGEEGQEAMEAPMAPPEEEEEDDEESDIDDFIVDDDGQPLKKPKWRKKLPGYTDAAL    141 - 210
QEAQEIFGVDFDYDEFEKYNEYDEELEEEYEYEDDEAEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESS    211 - 280
HLTDQDNEIRATDLPERFQLRSIPVKGAEDDELEEEADWIYRNAFATPTISLQESCDYLDRGQPASSFSR    281 - 350
KGPSTIQKIKEALGFMRNQHFEVPFIAFYRKEYVEPELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKM    351 - 420
QAYQYEQISADPDKPLADGIRALDTTDMERLKDVQSMDELKDVYNHFLLYYGRDIPKMQNAAKASRKKLK    421 - 490
RVREEGDEEGEGDEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFGLTPEQFGENLRDSYQRHETE    491 - 560
QFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKLNITPTKKGRKDVDE    561 - 630
AHYAYSFKYLKNKPVKELRDDQFLKICLAEDEGLLTTDISIDLKGVEGYGNDQTYFEEIKQFYYRDEFSH    631 - 700
QVQEWNRQRTMAIERALQQFLYVQMAKELKNKLLAEAKEYVIKACSRKLYNWLRVAPYRPDQQVEEDDDF    701 - 770
MDENQGKGIRVLGIAFSSARDHPVFCALVNGEGEVTDFLRLPHFTKRRTAWREEEREKKAQDIETLKKFL    771 - 840
LNKKPHVVTVAGENRDAQMLIEDVKRIVHELDQGQQLSSIGVELVDNELAILYMNSKKSEAEFRDYPPVL    841 - 910
RQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYCEFINRVNEVGVDVNRAIAHP    911 - 980
YSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTMCHMGPKVFMNCAGFLKIDTASLGDSTDSYI    981 - 1050
EVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKH   1051 - 1120
ITLYDIRAELSCRYKDLRTAYRSPNTEEIFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAIRN   1121 - 1190
DETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVG   1191 - 1260
MTVHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQQRTTYIKRVI   1261 - 1330
AHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQHVDVREEGKENAFSLGATLWI   1331 - 1400
NSEEFEDLDEIVARYVQPMASFARDLLNHKYYQDCSGGDRKKLEELLIKTKKEKPTFIPYFICACKELPG   1401 - 1470
KFLLGYQPRGKPRIEYVTVTPEGFRYRGQIFPTVNGLFRWFKDHYQDPVPGITPSSSSRTRTPASINATP   1471 - 1540
ANINLADLTRAVNALPQNMTSQMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQ   1541 - 1610
PVATPLMTPSYSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQ   1611 - 1680
WLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR                           1681 - 1726
//

Text Mined References (36)

PMID Year Title
25590759 2015 The integrase cofactor LEDGF/p75 associates with Iws1 and Spt6 for postintegration silencing of HIV-1 gene expression in latently infected cells.
24441044 2015 SUPT6H controls estrogen receptor activity and cellular differentiation by multiple epigenomic mechanisms.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23503590 2013 The histone chaperone Spt6 coordinates histone H3K27 demethylation and myogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22843687 2012 The histone chaperone Spt6 is required for activation-induced cytidine deaminase target determination through H3K4me3 regulation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22567361 2011 Histone Chaperones Spt6 and FACT: Similarities and Differences in Modes of Action at Transcribed Genes.
22316138 2012 Spt6 levels are modulated by PAAF1 and proteasome to regulate the HIV-1 LTR.
More...