Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.10
PubTator Score 23.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.200 0.001
juvenile dermatomyositis 1.053 0.000
primary Sjogren syndrome 1.100 0.015
ovarian cancer -1.300 0.000
dermatomyositis 1.200 0.002

Synonym

Accession Q7KYR7 B4DLP9 E9PGR4 O00475 P78408 Q59EN4 Q7KYQ7 Q7Z386 Q96AV7 Q9NU62
Symbols BTF1
BT2.1
BTN2.1
DJ3E1.1
BK14H9.1

Gene

PANTHER Protein Class (2)

Gene RIF (10)

PMID Text
24452779 A comparison of the allele frequencies or genotype distributions by the chi2 test revealed that rs6929846 of BTN2A1 was significantly associated with dyslipidemia.
22576629 Genetic variants of APOA5 and BTN2A1 may synergistically affect the prevalence of dyslipidemia in East Asian populations and of metabolic syndrome in Japanese individuals.
21784758 Genotype distributions and allele frequencies of the C/T polymorphism (rs6929846) were significantly associated with metabolic syndrome in Japanese subjects, but not in the Korean population.
21672009 BTN2A1 may be a susceptibility gene for Type 2 diabetes in Japanese individuals
21557786 Results suggest that BTN2A1 may be a susceptibility gene for chronic kidney disease in Japanese individuals.
21525964 BTN2A1 may be a susceptibility gene for hypertension in Japanese individuals, with the T allele being related to high blood pressure.
21468600 The relationship between rs6929846 of BTN2A1 or rs2569512 of ILF3 and myocardial infarction is influenced by the serum concentrations of high density lipoprotein cholesterol and low density lipoprotein cholesterol, respectively.
21347509 associations of rs6929846 of butyrophilin subfamily 2 member A1 to myocardial infarction among individuals stratified by the absence or presence of hypertension, diabetes mellitus and chronic kidney disease
21211798 BTN2A1 may be a susceptibility gene for myocardial infarction in Japanese individuals.
17785817 Rather than interacting with T cells, butyrophilin BTN2A1 is recognized by DC-SIGN on immature monocyte-derived dendritic cells.

AA Sequence

MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQ      1 - 70
FSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHL     71 - 140
VVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIR    141 - 210
DKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILS    211 - 280
GEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLDPDTAHPDLFLSEDRRSV    281 - 350
RRCPFRHLGESVPDNPERFDSQPCVLGRESFASGKHYWEVEVENVIEWTVGVCRDSVERKGEVLLIPQNG    351 - 420
FWTLEMHKGQYRAVSSPDRILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFSVPVRPFFRL    421 - 490
GCEDSPIFICPALTGANGVTVPEEGLTLHRVGTHQSL                                     491 - 527
//

Text Mined References (22)

PMID Year Title
24452779 2014 Association of a polymorphism of BTN2A1 with dyslipidemia in community-dwelling individuals.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22576629 2012 Synergistic effects of genetic variants of APOA5 and BTN2A1 on dyslipidemia or metabolic syndrome.
21784758 2011 Association of a genetic variant of BTN2A1 with metabolic syndrome in East Asian populations.
21672009 2011 Association of a polymorphism of BTN2A1 with type 2 diabetes mellitus in Japanese individuals.
21557786 2011 Association of a genetic variant of BTN2A1 with chronic kidney disease in Japanese individuals.
21525964 2011 Association of a polymorphism of BTN2A1 with hypertension in Japanese individuals.
21468600 Association of polymorphisms of BTN2A1 and ILF3 with myocardial infarction in Japanese individuals with different lipid profiles.
21347509 2011 Association of polymorphisms of BTN2A1 and ILF3 with myocardial infarction in Japanese individuals with or without hypertension, diabetes mellitus or chronic kidney disease.
21211798 2011 Association of a polymorphism of BTN2A1 with myocardial infarction in East Asian populations.
More...