Property Summary

NCBI Gene PubMed Count 19
PubMed Score 24.10
PubTator Score 23.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
juvenile dermatomyositis 1187 3.1e-11
ovarian cancer 8520 5.0e-08
glioblastoma 5792 1.1e-03
dermatomyositis 966 2.3e-03
primary Sjogren syndrome 735 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Ankylosing spondylitis 140 0.0 1.6
Rheumatoid arthritis 1191 0.0 0.8
Disease Target Count Z-score Confidence
Myocardial Infarction 151 3.697 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
dermatomyositis 1.200 2.3e-03
glioblastoma 1.200 1.1e-03
juvenile dermatomyositis 1.053 3.1e-11
ovarian cancer -1.300 5.0e-08
primary Sjogren syndrome 1.100 1.5e-02

Gene RIF (10)

AA Sequence

MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQ      1 - 70
FSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHL     71 - 140
VVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIR    141 - 210
DKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILS    211 - 280
GEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLDPDTAHPDLFLSEDRRSV    281 - 350
RRCPFRHLGESVPDNPERFDSQPCVLGRESFASGKHYWEVEVENVIEWTVGVCRDSVERKGEVLLIPQNG    351 - 420
FWTLEMHKGQYRAVSSPDRILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFSVPVRPFFRL    421 - 490
GCEDSPIFICPALTGANGVTVPEEGLTLHRVGTHQSL                                     491 - 527
//

Text Mined References (22)

PMID Year Title