Property Summary

NCBI Gene PubMed Count 21
PubMed Score 1.52
PubTator Score 8.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active ulcerative colitis -1.011 3.6e-02
adult high grade glioma -1.100 1.3e-03
astrocytic glioma 1.800 1.7e-02
atypical teratoid / rhabdoid tumor -1.500 1.4e-04
Breast cancer -1.300 1.5e-14
breast carcinoma -1.500 2.9e-06
cystic fibrosis and chronic rhinosinusit... 1.430 3.2e-03
ductal carcinoma in situ -1.200 2.5e-04
glioblastoma -1.100 4.7e-03
interstitial lung disease 1.100 2.5e-03
intraductal papillary-mucinous carcinoma... -1.300 1.4e-02
intraductal papillary-mucinous neoplasm ... -1.300 3.5e-02
invasive ductal carcinoma -1.500 1.3e-03
lung cancer -1.200 2.1e-03
medulloblastoma, large-cell -1.100 4.2e-04
oligodendroglioma 2.400 6.5e-03
osteosarcoma -1.398 4.2e-03
ovarian cancer -1.400 1.6e-04
Pick disease 1.100 2.5e-03
posterior fossa group B ependymoma -1.100 7.8e-05
psoriasis -1.200 3.8e-06
subependymal giant cell astrocytoma -1.087 3.8e-02
tuberculosis and treatment for 3 months 1.100 9.1e-03

Gene RIF (11)

AA Sequence

MALGEEKAEAEASEDTKAQSYGRGSCRERELDIPGPMSGEQPPRLEAEGGLISPVWGAEGIPAPTCWIGT      1 - 70
DPGGPSRAHQPQASDANREPVAERSEPALSGLPPATMGSGDLLLSGESQVEKTKLSSSEEFPQTLSLPRT     71 - 140
TTICSGHDADTEDDPSLADLPQALDLSQQPHSSGLSCLSQWKSVLSPGSAAQPSSCSISASSTGSSLQGH    141 - 210
QERAEPRGGSLAKVSSSLEPVVPQEPSSVVGLGPRPQWSPQPVFSGGDASGLGRRRLSFQAEYWACVLPD    211 - 280
SLPPSPDRHSPLWNPNKEYEDLLDYTYPLRPGPQLPKHLDSRVPADPVLQDSGVDLDSFSVSPASTLKSP    281 - 350
TNVSPNCPPAEATALPFSGPREPSLKQWPSRVPQKQGGMGLASWSQLASTPRAPGSRDARWERREPALRG    351 - 420
AKDRLTIGKHLDMGSPQLRTRDRGWPSPRPEREKRTSQSARRPTCTESRWKSEEEVESDDEYLALPARLT    421 - 490
QVSSLVSYLGSISTLVTLPTGDIKGQSPLEVSDSDGPASFPSSSSQSQLPPGAALQGSGDPEGQNPCFLR    491 - 560
SFVRAHDSAGEGSLGSSQALGVSSGLLKTRPSLPARLDRWPFSDPDVEGQLPRKGGEQGKESLVQCVKTF    561 - 630
CCQLEELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDIDEHQSLTESVLQKGEILLQCLLENT    631 - 700
PVLEDVLGRIAKQSGELESHADRLYDSILASLDMLAGCTLIPDKKPMAAMEHPCEGV                 701 - 757
//

Text Mined References (23)

PMID Year Title