Property Summary

NCBI Gene PubMed Count 19
PubMed Score 1.50
PubTator Score 8.54

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q76N32 B4DRQ1 D6W5F1 D6W5F2 O60326 Q9BQ18 Q9UDM9 Cep68
Symbols KIAA0582

Gene

Gene RIF (9)

PMID Text
25704143 C-terminal 300-400 amino acids of Cep68 are necessary to localize Cep68 to interphase centrosomes while C-terminal 400-500 amino acids might regulate Cep68 dissociation from centrosomes at mitotic onset.
25503564 Cep68 degradation allows Cep215 removal from peripheral pericentriolar material (PCM) preventing centriole separation following disengagement, PCNT cleavage mediates Cep215 removal from core of the PCM to inhibit centriole disengagement and duplication
24618698 CEP68 gene variants may play an important role in MNSAID-UA susceptibility and, despite the different regulatory mechanisms involved depending on the specific affected organ, in the development of hypersensitivity reactions to NSAIDs.
24554434 Centlein complexes with C-Nap1 and Cep68 at the proximal ends of centrioles during interphase.
21072201 Findings imply that CEP68 could be a susceptible gene for aspirin intolerance in asthmatics.
21072201 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18854154 Knockdown of centrosomal protein 68kDa (CEP68) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18042621 data suggest that Cep68 cooperates with rootletin and C-Nap1 in centrosome cohesion.
17570516 our study is the first to identify and validate Endofin, DCBLD2, and KIAA0582 as part of a complex EGF phosphotyrosine signaling network

AA Sequence

MALGEEKAEAEASEDTKAQSYGRGSCRERELDIPGPMSGEQPPRLEAEGGLISPVWGAEGIPAPTCWIGT      1 - 70
DPGGPSRAHQPQASDANREPVAERSEPALSGLPPATMGSGDLLLSGESQVEKTKLSSSEEFPQTLSLPRT     71 - 140
TTICSGHDADTEDDPSLADLPQALDLSQQPHSSGLSCLSQWKSVLSPGSAAQPSSCSISASSTGSSLQGH    141 - 210
QERAEPRGGSLAKVSSSLEPVVPQEPSSVVGLGPRPQWSPQPVFSGGDASGLGRRRLSFQAEYWACVLPD    211 - 280
SLPPSPDRHSPLWNPNKEYEDLLDYTYPLRPGPQLPKHLDSRVPADPVLQDSGVDLDSFSVSPASTLKSP    281 - 350
TNVSPNCPPAEATALPFSGPREPSLKQWPSRVPQKQGGMGLASWSQLASTPRAPGSRDARWERREPALRG    351 - 420
AKDRLTIGKHLDMGSPQLRTRDRGWPSPRPEREKRTSQSARRPTCTESRWKSEEEVESDDEYLALPARLT    421 - 490
QVSSLVSYLGSISTLVTLPTGDIKGQSPLEVSDSDGPASFPSSSSQSQLPPGAALQGSGDPEGQNPCFLR    491 - 560
SFVRAHDSAGEGSLGSSQALGVSSGLLKTRPSLPARLDRWPFSDPDVEGQLPRKGGEQGKESLVQCVKTF    561 - 630
CCQLEELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDIDEHQSLTESVLQKGEILLQCLLENT    631 - 700
PVLEDVLGRIAKQSGELESHADRLYDSILASLDMLAGCTLIPDKKPMAAMEHPCEGV                 701 - 757
//

Text Mined References (21)

PMID Year Title
25704143 Cep68 can be regulated by Nek2 and SCF complex.
25503564 2015 Degradation of Cep68 and PCNT cleavage mediate Cep215 removal from the PCM to allow centriole separation, disengagement and licensing.
25416956 2014 A proteome-scale map of the human interactome network.
24618698 2014 Variants of CEP68 gene are associated with acute urticaria/angioedema induced by multiple non-steroidal anti-inflammatory drugs.
24554434 2014 Centlein mediates an interaction between C-Nap1 and Cep68 to maintain centrosome cohesion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21072201 2010 Genome-wide and follow-up studies identify CEP68 gene variants associated with risk of aspirin-intolerant asthma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18042621 2007 Cep68 and Cep215 (Cdk5rap2) are required for centrosome cohesion.
More...