Property Summary

NCBI Gene PubMed Count 19
PubMed Score 70.84
PubTator Score 17.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Dermatitis, Atopic 37 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Atopic dermatitis 952 0.0 9.44696769637695E-6

Expression

  Differential Expression (34)

Disease log2 FC p
Atopic dermatitis -2.200 9.4e-06
adult high grade glioma 1.200 1.0e-02
astrocytic glioma 1.600 6.6e-03
Astrocytoma, Pilocytic 1.100 3.5e-03
atypical teratoid/rhabdoid tumor -1.100 7.7e-04
autosomal dominant Emery-Dreifuss muscul... 1.700 5.0e-03
Becker muscular dystrophy 1.518 1.3e-03
Breast cancer 1.400 3.3e-04
breast carcinoma -1.400 9.7e-04
cystic fibrosis -1.617 3.3e-04
diabetes mellitus -2.100 7.2e-03
Duchenne muscular dystrophy 2.828 2.0e-10
ependymoma 1.300 2.3e-02
fascioscapulohumeral muscular dystrophy 1.025 2.2e-04
fibroadenoma -1.800 3.3e-03
gastric carcinoma 2.500 2.4e-02
glioblastoma 1.600 3.0e-04
head and neck cancer -1.400 2.6e-02
interstitial cystitis 1.300 1.8e-02
intraductal papillary-mucinous adenoma (... -1.700 2.4e-04
intraductal papillary-mucinous carcinoma... -1.600 5.6e-04
intraductal papillary-mucinous neoplasm ... -1.600 3.9e-03
invasive ductal carcinoma -1.900 1.1e-02
juvenile dermatomyositis 1.303 7.5e-08
limb girdle muscular dystrophy 2A 1.940 3.3e-06
lung carcinoma -2.200 4.4e-10
nasopharyngeal carcinoma -1.600 4.5e-05
non primary Sjogren syndrome sicca 1.300 1.5e-02
oligodendroglioma 1.500 1.3e-02
ovarian cancer -3.000 6.9e-13
pancreatic cancer 1.600 5.5e-03
Pick disease 1.700 2.4e-02
pituitary cancer 1.600 5.8e-03
primary pancreatic ductal adenocarcinoma 3.420 4.2e-05

 CSPA Cell Line (2)

Gene RIF (8)

AA Sequence

MTWRMGPRFTMLLAMWLVCGSEPHPHATIRGSHGGRKVPLVSPDSSRPARFLRHTGRSRGIERSTLEEPN      1 - 70
LQPLQRRRSVPVLRLARPTEPPARSDINGAAVRPEQRPAARGSPREMIRDEGSSARSRMLRFPSGSSSPN     71 - 140
ILASFAGKNRVWVISAPHASEGYYRLMMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKVRRITSEGQIL    141 - 210
EQPLDPSLIPKLMSFLKLEKGKFGMVLLKKTLQVEERYPYPVRLEAMYEVIDQGPIRRIEKIRQKGFVQK    211 - 280
CKASGVEGQVVAEGNDGGGGAGRPSLGSEKKKEDPRRAQVPPTRESRVKVLRKLAATAPALPQPPSTPRA    281 - 350
TTLPPAPATTVTRSTSRAVTVAARPMTTTAFPTTQRPWTPSPSHRPPTTTEVITARRPSVSENLYPPSRK    351 - 420
DQHRERPQTTRRPSKATSLESFTNAPPTTISEPSTRAAGPGRFRDNRMDRREHGHRDPNVVPGPPKPAKE    421 - 490
KPPKKKAQDKILSNEYEEKYDLSRPTASQLEDELQVGNVPLKKAKESKKHEKLEKPEKEKKKKMKNENAD    491 - 560
KLLKSEKQMKKSEKKSKQEKEKSKKKKGGKTEQDGYQKPTNKHFTQSPKKSVADLLGSFEGKRRLLLITA    561 - 630
PKAENNMYVQQRDEYLESFCKMATRKISVITIFGPVNNSTMKIDHFQLDNEKPMRVVDDEDLVDQRLISE    631 - 700
LRKEYGMTYNDFFMVLTDVDLRVKQYYEVPITMKSVFDLIDTFQSRIKDMEKQKKEGIVCKEDKKQSLEN    701 - 770
FLSRFRWRRRLLVISAPNDEDWAYSQQLSALSGQACNFGLRHITILKLLGVGEEVGGVLELFPINGSSVV    771 - 840
EREDVPAHLVKDIRNYFQVSPEYFSMLLVGKDGNVKSWYPSPMWSMVIVYDLIDSMQLRRQEMAIQQSLG    841 - 910
MRCPEDEYAGYGYHSYHQGYQDGYQDDYRHHESYHHGYPY                                  911 - 950
//

Text Mined References (21)

PMID Year Title