Property Summary

NCBI Gene PubMed Count 19
Grant Count 16
R01 Count 5
Funding $1,819,989.2
PubMed Score 71.50
PubTator Score 17.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25029241 Ccdc80 is a novel betacat-regulated gene in adrenocortical cells
23831687 activation of PKGI with cGMP regulated SSG1 intracellular distribution.
23666966 Data suggest that CCDC80 expression is down-regulated in many thyroid carcinomas; loss of heterozygosity partially accounts for CCDC80 down-regulation in thyroid carcinoma; CCDC80 expression positively regulates expression of E-cadherin.
21871888 Results reveal DRO1 as an AIB1-targeted tumor suppressor, providing a novel mechanism for AIB1-dependent inhibition of apoptosis.
18178152 In conclusion, the expression pattern of URB suggests its role in obesity and the results suggest that URB is secreted, at least in part, from adipocytes.
15998583 URB is expressed in human dermal papilla cells
15325258 Downregulated during osteoblastic differentiation of bone marrow stromal cells. Suggests role in skeletogenesis.
209648 The CCDC80 protein has three P-DUDES structural domains. These domains have significant albeit remote sequence similarity to thioredoxin-like domains and are predicted to have an oxidoreductase function.

AA Sequence

MTWRMGPRFTMLLAMWLVCGSEPHPHATIRGSHGGRKVPLVSPDSSRPARFLRHTGRSRGIERSTLEEPN      1 - 70
LQPLQRRRSVPVLRLARPTEPPARSDINGAAVRPEQRPAARGSPREMIRDEGSSARSRMLRFPSGSSSPN     71 - 140
ILASFAGKNRVWVISAPHASEGYYRLMMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKVRRITSEGQIL    141 - 210
EQPLDPSLIPKLMSFLKLEKGKFGMVLLKKTLQVEERYPYPVRLEAMYEVIDQGPIRRIEKIRQKGFVQK    211 - 280
CKASGVEGQVVAEGNDGGGGAGRPSLGSEKKKEDPRRAQVPPTRESRVKVLRKLAATAPALPQPPSTPRA    281 - 350
TTLPPAPATTVTRSTSRAVTVAARPMTTTAFPTTQRPWTPSPSHRPPTTTEVITARRPSVSENLYPPSRK    351 - 420
DQHRERPQTTRRPSKATSLESFTNAPPTTISEPSTRAAGPGRFRDNRMDRREHGHRDPNVVPGPPKPAKE    421 - 490
KPPKKKAQDKILSNEYEEKYDLSRPTASQLEDELQVGNVPLKKAKESKKHEKLEKPEKEKKKKMKNENAD    491 - 560
KLLKSEKQMKKSEKKSKQEKEKSKKKKGGKTEQDGYQKPTNKHFTQSPKKSVADLLGSFEGKRRLLLITA    561 - 630
PKAENNMYVQQRDEYLESFCKMATRKISVITIFGPVNNSTMKIDHFQLDNEKPMRVVDDEDLVDQRLISE    631 - 700
LRKEYGMTYNDFFMVLTDVDLRVKQYYEVPITMKSVFDLIDTFQSRIKDMEKQKKEGIVCKEDKKQSLEN    701 - 770
FLSRFRWRRRLLVISAPNDEDWAYSQQLSALSGQACNFGLRHITILKLLGVGEEVGGVLELFPINGSSVV    771 - 840
EREDVPAHLVKDIRNYFQVSPEYFSMLLVGKDGNVKSWYPSPMWSMVIVYDLIDSMQLRRQEMAIQQSLG    841 - 910
MRCPEDEYAGYGYHSYHQGYQDGYQDDYRHHESYHHGYPY                                  911 - 950
//

Text Mined References (21)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25029241 2014 Wnt signaling inhibits adrenal steroidogenesis by cell-autonomous and non-cell-autonomous mechanisms.
23831687 2013 Steroid-sensitive gene 1 is a novel cyclic GMP-dependent protein kinase I substrate in vascular smooth muscle cells.
23666966 2013 Tumor suppressor role of the CL2/DRO1/CCDC80 gene in thyroid carcinogenesis.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
21871888 2011 Transcriptional repression of the tumor suppressor DRO1 by AIB1.
18178152 2008 URB is abundantly expressed in adipose tissue and dysregulated in obesity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...