Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.61
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession Q76KD6 B4DWW9 Q5U5I8 Q7Z6L7
Symbols SPATA15

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (1)

AA Sequence

MSLLTNYEGLRHQIERLVRENEELKKLVRLIRENHELKSAIKTQAGGLGISGFTSGLGEATAGLSSRQNN      1 - 70
GVFLPPSPAVANERVLEEVGIMALAPLAEMLTSLQPSATPGSLMSPLTGTLSTLLSGPAPTSQSSPLTSF     71 - 140
LTSPIAGPLTGTLASSLGLPSTGTLTPSSLVAGPVAMSQSSPLIAPVMGTVAVSLSSPLLSSTATPPGVS    141 - 210
QNLLANPMSNLVLPEAPRLRLAEPLRGGPTGPQSPACVVPTATTKVPLSTEPPQSTQDPEPLSMAFAGAP    211 - 280
LQTSTPIGAMGTPAPKTAFSFNTSDTQAQPSAAQEQVVPASVPTSPTTSPTVTVLASAPALAPQVATSYT    281 - 350
PSSTTHIAQGAPHPPSRMHNSPTQNLPVPHCPPHNAHSPPRTSSSPASVNDSRGPRTTEPSTKSMMEVER    351 - 420
KLAHRKTSKFPENPRESKQLAWERLVGEIAFQLDRRILSSIFPERVRLYGFTVSNIPEKIIQASLNPSDH    421 - 490
KLDEKLCQRLTQRYVSVMNRLQSLGYNGRVHPALTEQLVNAYGILRERPELAASEGGPYTVDFLQRVVVE    491 - 560
TVHPGMLADALLLLSCLSQLAHDDGKPMFIW                                           561 - 591
//

Text Mined References (7)

PMID Year Title