Property Summary

NCBI Gene PubMed Count 7
PubMed Score 82.12
PubTator Score 33.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.900 8.6e-05
Astrocytoma, Pilocytic -1.900 4.1e-08
atypical teratoid / rhabdoid tumor -2.300 2.1e-07
Breast cancer -2.200 3.8e-02
glioblastoma -1.700 3.6e-08
medulloblastoma -1.200 1.3e-03
medulloblastoma, large-cell -2.000 2.4e-05
osteosarcoma -1.731 5.5e-07
posterior fossa group A ependymoma -1.200 1.8e-07
psoriasis -1.200 6.8e-42
subependymal giant cell astrocytoma -2.270 1.7e-02

Synonym

Accession Q76G19 B3KXB1 B7ZKY3 Q8NB75 Q9BUH9 Q9P284
Symbols LU1
LNX5
PDZK4
PDZRN4L

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (2)

AA Sequence

MGCNMCVVQKPEEQYKVMLQVNGKELSKLSQEQTLQALRSSKEPLVIQVLRRSPRLRGDSSCHDLQLVDS      1 - 70
GTQTDITFEHIMALGKLRPPTPPMVILEPPPISHEYYDPAEFMEGGPQEADRLDELEYEEVELYKSSHRD     71 - 140
KLGLMVCYRTDDEEDLGIYVGEVNPNSIAAKDGRIREGDRIIQINGVDVQNREEAVAILSQEENTNISLL    141 - 210
VARPESQLAKRWKDSDRDDFLDDFGSENEGELRARKLKSPPAQQPGNEEEKGAPDAGPGLSNSQELDSGV    211 - 280
GRTDESTRNEESSEHDLLGDEPPSSTNTPGSLRKFGLQGDALQSRDFHFSMDSLLAEGAGLGGGDVPGLT    281 - 350
DEEYERYRELLEIKCHLENGNQLGLLFPRASGGNSALDVNRNESLGHEMAMLEEELRHLEFKCRNILRAQ    351 - 420
KMQQLRERCMKAWLLEEESLYDLAASEPKKHELSDISELPEKSDKDSTSAYNTGESCRSTPLLVEPLPES    421 - 490
PLRRAMAGNSNLNRTPPGPAVATPAKAAPPPGSPAKFRSLSRDPEAGRRQHAEERGRRNPKTGLTLERVG    491 - 560
PESSPYLSRRHRGQGQEGEHYHSCVQLAPTRGLEELGHGPLSLAGGPRVGGVAAAATEAPRMEWKVKVRS    561 - 630
DGTRYVAKRPVRDRLLKARALKIREERSGMTTDDDAVSEMKMGRYWSKEERKQHLIRAREQRKRREFMMQ    631 - 700
SRLECLREQQNGDSKPELNIIALSHRKTMKKRNKKILDNWITIQEMLAHGARSADGKRVYNPLLSVTTV     701 - 769
//

Text Mined References (10)

PMID Year Title