Property Summary

NCBI Gene PubMed Count 7
PubMed Score 75.09
PubTator Score 33.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma -2.100 0.000
osteosarcoma -1.731 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
sonic hedgehog group medulloblastoma -1.500 0.000
medulloblastoma, large-cell -2.000 0.000
Breast cancer -2.200 0.038
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -1.900 0.000
posterior fossa group A ependymoma -1.200 0.000
subependymal giant cell astrocytoma -2.270 0.017
psoriasis -1.200 0.000

Gene RIF (2)

PMID Text
15138636 PDZRN4L showed 49.9% total-amino-acid identity with PDZRN4 short isoform (PDZRN4S). PDZ, PR34H1 and PR34H2 domains were conserved between PDZRN4L and PDZRN4S.
15077175 Might play an important role in the proliferation of SS cells and might be a suitable target for SS drugs.

AA Sequence

MGCNMCVVQKPEEQYKVMLQVNGKELSKLSQEQTLQALRSSKEPLVIQVLRRSPRLRGDSSCHDLQLVDS      1 - 70
GTQTDITFEHIMALGKLRPPTPPMVILEPPPISHEYYDPAEFMEGGPQEADRLDELEYEEVELYKSSHRD     71 - 140
KLGLMVCYRTDDEEDLGIYVGEVNPNSIAAKDGRIREGDRIIQINGVDVQNREEAVAILSQEENTNISLL    141 - 210
VARPESQLAKRWKDSDRDDFLDDFGSENEGELRARKLKSPPAQQPGNEEEKGAPDAGPGLSNSQELDSGV    211 - 280
GRTDESTRNEESSEHDLLGDEPPSSTNTPGSLRKFGLQGDALQSRDFHFSMDSLLAEGAGLGGGDVPGLT    281 - 350
DEEYERYRELLEIKCHLENGNQLGLLFPRASGGNSALDVNRNESLGHEMAMLEEELRHLEFKCRNILRAQ    351 - 420
KMQQLRERCMKAWLLEEESLYDLAASEPKKHELSDISELPEKSDKDSTSAYNTGESCRSTPLLVEPLPES    421 - 490
PLRRAMAGNSNLNRTPPGPAVATPAKAAPPPGSPAKFRSLSRDPEAGRRQHAEERGRRNPKTGLTLERVG    491 - 560
PESSPYLSRRHRGQGQEGEHYHSCVQLAPTRGLEELGHGPLSLAGGPRVGGVAAAATEAPRMEWKVKVRS    561 - 630
DGTRYVAKRPVRDRLLKARALKIREERSGMTTDDDAVSEMKMGRYWSKEERKQHLIRAREQRKRREFMMQ    631 - 700
SRLECLREQQNGDSKPELNIIALSHRKTMKKRNKKILDNWITIQEMLAHGARSADGKRVYNPLLSVTTV     701 - 769
//

Text Mined References (10)

PMID Year Title
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15138636 2004 Identification and characterization of human PDZRN4L gene and mouse Pdzrn4l gene in silico.
15077175 2004 Identification of PDZK4, a novel human gene with PDZ domains, that is upregulated in synovial sarcomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8661155 1996 The genomic organization of a human creatine transporter (CRTR) gene located in Xq28.