Property Summary

NCBI Gene PubMed Count 8
PubMed Score 38.78
PubTator Score 8.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (2)

AA Sequence

MTAGGQAEAEGAGGEPGAARLPSRVARLLSALFYGTCSFLIVLVNKALLTTYGFPSPIFLGIGQMAATIM      1 - 70
ILYVSKLNKIIHFPDFDKKIPVKLFPLPLLYVGNHISGLSSTSKLSLPMFTVLRKFTIPLTLLLETIILG     71 - 140
KQYSLNIILSVFAIILGAFIAAGSDLAFNLEGYIFVFLNDIFTAANGVYTKQKMDPKELGKYGVLFYNAC    141 - 210
FMIIPTLIISVSTGDLQQATEFNQWKNVVFILQFLLSCFLGFLLMYSTVLCSYYNSALTTAVVGAIKNVS    211 - 280
VAYIGILIGGDYIFSLLNFVGLNICMAGGLRYSFLTLSSQLKPKPVGEENICLDLKS                 281 - 337
//

Text Mined References (11)

PMID Year Title