Property Summary

NCBI Gene PubMed Count 8
Grant Count 5
R01 Count 5
Funding $944,550
PubMed Score 37.67
PubTator Score 8.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q76EJ3 O95454 Q498C1 Q75W21 Q7Z5X5
Symbols hfrc
HFRC1
SQV7L
UGTrel8

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
19276090 HFRC1 was overexpressed in human bronchial epithelial cells and was shown to localize in the Golgi and to enhance the surface expression of N-acetylglucosamine-rich glycans.
15082721 HFRC1 takes part in the synthesis of heparan sulfate by regulating the level of UDP-GlcNAc, a donor substrate for the heparan sulfate synthases

AA Sequence

MTAGGQAEAEGAGGEPGAARLPSRVARLLSALFYGTCSFLIVLVNKALLTTYGFPSPIFLGIGQMAATIM      1 - 70
ILYVSKLNKIIHFPDFDKKIPVKLFPLPLLYVGNHISGLSSTSKLSLPMFTVLRKFTIPLTLLLETIILG     71 - 140
KQYSLNIILSVFAIILGAFIAAGSDLAFNLEGYIFVFLNDIFTAANGVYTKQKMDPKELGKYGVLFYNAC    141 - 210
FMIIPTLIISVSTGDLQQATEFNQWKNVVFILQFLLSCFLGFLLMYSTVLCSYYNSALTTAVVGAIKNVS    211 - 280
VAYIGILIGGDYIFSLLNFVGLNICMAGGLRYSFLTLSSQLKPKPVGEENICLDLKS                 281 - 337
//

Text Mined References (11)

PMID Year Title
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23144319 2013 Prognostic implications of genetic variants in advanced non-small cell lung cancer: a genome-wide association study.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19276090 2009 Endoplasmic reticulum/golgi nucleotide sugar transporters contribute to the cellular release of UDP-sugar signaling molecules.
15607426 2005 Identification and characterization of human Golgi nucleotide sugar transporter SLC35D2, a novel member of the SLC35 nucleotide sugar transporter family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15082721 2004 Molecular cloning and characterization of a human multisubstrate specific nucleotide-sugar transporter homologous to Drosophila fringe connection.
12759756 2004 Molecular physiology and pathology of the nucleotide sugar transporter family (SLC35).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...