Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.33
PubTator Score 13.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -4.400 0.000
posterior fossa group B ependymoma -3.000 0.000
medulloblastoma -3.200 0.000
glioblastoma -1.900 0.046
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -2.200 0.034
colon cancer -3.100 0.000
active Crohn's disease -2.031 0.032
pilocytic astrocytoma 1.600 0.006
subependymal giant cell astrocytoma -1.393 0.044
ductal carcinoma in situ 3.000 0.040
ulcerative colitis -1.800 0.000
pituitary cancer 4.800 0.000

Synonym

Accession Q76B58 B3KVP1 B7Z260 O95726 Q2M330
Symbols FAM5C
DBCCR1L
DBCCR1L1

Gene

Gene RIF (14)

PMID Text
25887438 study provides evidence that the BRINP3 polymorphic variant rs1342913 and low level of BRINP3 expression are associated with peri-implantitis, independently from the presence of chronic periodontitis.
25251368 Data show that family with sequence similarity 5 member C protein FAM5C-positive endothelium expressed intercellular adhesion molecule-1 (ICAM-1) or vascular cell adhesion molecule-1 (VCAM-1).
25171508 Under expression of BRINP3 is associated with the pathogenesis of ulcerative colitis.
22377736 Hypermethylated FAM5C and MYLK in serum are strongly associated with the development of gastric cancer and can be used as potential biomarkers for diagnosis and pre-warning.
22355820 expression does not contribute to chronic periodontitis
22013132 findings suggest a protective effect of T allele in women with a history of myocardial infarction (MI;) genotype of FAM5C rs10920501 explained about 7percent of variability of age of onset of coronary heart disease in women who have had an MI; FAM5C remains a gene of interest in a complex disease process
20383335 FAM5C mRNA expression was significantly higher in aggressive periodontitis diseased versus healthy sites, and was found to be correlated to the IL-1beta, IL-17A, IL-4 and RANKL mRNA levels.
20383335 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19787213 Loss of FAM5C is associated with tongue squamous cell carcinoma.
More...

AA Sequence

MIWRSRAGAELFSLMALWEWIALSLHCWVLAVAAVSDQHATSPFDWLLSDKGPFHRSQEYTDFVDRSRQG      1 - 70
FSTRYKIYREFGRWKVNNLAVERRNFLGSPLPLAPEFFRNIRLLGRRPTLQQITENLIKKYGTHFLLSAT     71 - 140
LGGEESLTIFVDKRKLSKRAEGSDSTTNSSSVTLETLHQLAASYFIDRDSTLRRLHHIQIASTAIKVTET    141 - 210
RTGPLGCSNYDNLDSVSSVLVQSPENKIQLQGLQVLLPDYLQERFVQAALSYIACNSEGEFICKENDCWC    211 - 280
HCGPKFPECNCPSMDIQAMEENLLRITETWKAYNSDFEESDEFKLFMKRLPMNYFLNTSTIMHLWTMDSN    281 - 350
FQRRYEQLENSMKQLFLKAQKIVHKLFSLSKRCHKQPLISLPRQRTSTYWLTRIQSFLYCNENGLLGSFS    351 - 420
EETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTRCGTCNTGYMLSQGLCKPEVAESTDHYIGFET    421 - 490
DLQDLEMKYLLQKTDRRIEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSNKYKSSLVHMILGLSLQICLT    491 - 560
KNSTLEPVLAVYVNPFGGSHSESWFMPVNENSFPDWERTKLDLPLQCYNWTLTLGNKWKTFFETVHIYLR    561 - 630
SRIKSNGPNGNESIYYEPLEFIDPSRNLGYMKINNIQVFGYSMHFDPEAIRDLILQLDYPYTQGSQDSAL    631 - 700
LQLLEIRDRVNKLSPPGQRRLDLFSCLLRHRLKLSTSEVVRIQSALQAFNAKLPNTMDYDTTKLCS        701 - 766
//

Text Mined References (19)

PMID Year Title
25887438 2015 Different contribution of BRINP3 gene in chronic periodontitis and peri-implantitis: a cross-sectional study.
25251368 2014 Family with sequence similarity 5, member C (FAM5C) increases leukocyte adhesion molecules in vascular endothelial cells: implication in vascular inflammation.
25171508 2014 Mucosal transcriptomics implicates under expression of BRINP3 in the pathogenesis of ulcerative colitis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22377736 2012 Hypermethylated FAM5C and MYLK in serum as diagnosis and pre-warning markers for gastric cancer.
22355820 2012 A preliminary study on the FAM5C expression in generalized chronic periodontitis.
22013132 2013 The relationships between FAM5C SNP (rs10920501) variability and metabolic syndrome and inflammation in women with coronary heart disease.
20383335 2010 FAM5C contributes to aggressive periodontitis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19787213 2009 Expression of the FAM5C in tongue squamous cell carcinoma.
More...