Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.76
PubTator Score 13.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease -2.031 3.2e-02
Astrocytoma, Pilocytic 1.600 5.6e-03
colon cancer -3.100 4.1e-08
ductal carcinoma in situ 3.000 4.0e-02
ependymoma -2.900 5.9e-08
glioblastoma -1.900 4.6e-02
group 3 medulloblastoma -2.400 5.8e-03
malignant mesothelioma -4.400 1.1e-09
medulloblastoma, large-cell -4.000 1.9e-05
pituitary cancer 4.800 1.6e-05
primitive neuroectodermal tumor -2.200 3.4e-02
subependymal giant cell astrocytoma -1.393 4.4e-02
ulcerative colitis -1.700 2.3e-06

Gene RIF (18)

AA Sequence

MIWRSRAGAELFSLMALWEWIALSLHCWVLAVAAVSDQHATSPFDWLLSDKGPFHRSQEYTDFVDRSRQG      1 - 70
FSTRYKIYREFGRWKVNNLAVERRNFLGSPLPLAPEFFRNIRLLGRRPTLQQITENLIKKYGTHFLLSAT     71 - 140
LGGEESLTIFVDKRKLSKRAEGSDSTTNSSSVTLETLHQLAASYFIDRDSTLRRLHHIQIASTAIKVTET    141 - 210
RTGPLGCSNYDNLDSVSSVLVQSPENKIQLQGLQVLLPDYLQERFVQAALSYIACNSEGEFICKENDCWC    211 - 280
HCGPKFPECNCPSMDIQAMEENLLRITETWKAYNSDFEESDEFKLFMKRLPMNYFLNTSTIMHLWTMDSN    281 - 350
FQRRYEQLENSMKQLFLKAQKIVHKLFSLSKRCHKQPLISLPRQRTSTYWLTRIQSFLYCNENGLLGSFS    351 - 420
EETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTRCGTCNTGYMLSQGLCKPEVAESTDHYIGFET    421 - 490
DLQDLEMKYLLQKTDRRIEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSNKYKSSLVHMILGLSLQICLT    491 - 560
KNSTLEPVLAVYVNPFGGSHSESWFMPVNENSFPDWERTKLDLPLQCYNWTLTLGNKWKTFFETVHIYLR    561 - 630
SRIKSNGPNGNESIYYEPLEFIDPSRNLGYMKINNIQVFGYSMHFDPEAIRDLILQLDYPYTQGSQDSAL    631 - 700
LQLLEIRDRVNKLSPPGQRRLDLFSCLLRHRLKLSTSEVVRIQSALQAFNAKLPNTMDYDTTKLCS        701 - 766
//

Text Mined References (23)

PMID Year Title