Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.95
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 1.6e-04
atypical teratoid/rhabdoid tumor 357 1.4e-03
Alzheimer's disease 658 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
Alzheimer's disease 1.200 4.3e-02
atypical teratoid/rhabdoid tumor -1.100 1.4e-03
group 3 medulloblastoma -2.300 1.6e-04

Gene RIF (2)

AA Sequence

METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGA      1 - 70
TRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKS     71 - 140
SDTLKLQKKARKELLGKGDLQPQLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNG    141 - 210
ELTMLGEITHLQGIIDDLVVLTAEPHKLPPASEQVIKDLKGSDYSWSYQTPPSSPSSSSSRKSSMCSAPS    211 - 280
SSSSAKGGGAPWPGGAQTYSPSSTCRYRSLAQPATTTARLSSVSSHDSGFVSQDATYSKPPSPMPSDITS    281 - 350
QKSSSSASSEASETCQSVSECSSPTSDWSKVGSHEQPSGATLQRRKDRVELLRDTEPGPASGGTLGPSGE    351 - 420
EAPRPRMSPATIAAKHGEEVSPAASDLAMVLTRGLSLEHQKSSRDSLQYSSGYSTQTTTPSCSEDTIPSQ    421 - 490
GSDYDCYSVNGDADSEGPPEFDKSSTIPRNSNIAQNYRRLIQTKRPASTAGLPTAGLPTATGLPSGAPPG    491 - 560
VATIRRTPSTKPTVRRALSSAGPIPIRPPIVPVKTPTVPDSPGYMGPTRAGSEECVFYTDETASPLAPDL    561 - 630
AKASPKRLSLPNTAWGSPSPEAAGYPGAGAEDEQQQLAANRHSLVEKLGELVAGAHALGEGQFPFPTALS    631 - 700
ATPTEETPTPPPAATSDPPAEDMLVAIRRGVRLRRTVTNDRSAPRIL                           701 - 747
//

Text Mined References (14)

PMID Year Title