Property Summary

NCBI Gene PubMed Count 12
Grant Count 15
R01 Count 9
Funding $1,018,064.84
PubMed Score 19.15
PubTator Score 34.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
24391740 family-based analysis of association between blood pressure, glomerular filtration and genes of the urotensin-II pathway (urotensin-II, urotensin-II related peptide, urotensin-II receptor) saturated with 28 tagging single nucleotide polymorphisms
21684671 U2B'' has a relaxed specificity for its RNA targets.
18000598 vascular remodelling processes in conjunction with enhanced vasoconstriction are involved in the pathogenesis of pulmonary hypertension; UII may play a novel role in the pathogenesis of this disorder
17919235 Elevated serum urotensin II is associated with chronic liver disease and portal hypertension
17327028 Urotensin II gene may contribute to the genetic susceptibility to gestational diabetes mellitus in Chinese population
16940699 These findings suggest that U-II plays key roles in accelerating the development of atherosclerosis, thereby leading to coronary artery disease.
14550283 URP could possibly be the endogenous and functional ligand for the human UII receptor

AA Sequence

MNKILSSTVCFGLLTLLSVLSFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLA      1 - 70
LPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV                          71 - 119
//

Text Mined References (13)

PMID Year Title
24391740 2013 Urotensin-II system in genetic control of blood pressure and renal function.
21684671 2011 Human U2B? protein binding to snRNA stemloops.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
18000598 2007 Urotensin-II in the lung: a matter for vascular remodelling and pulmonary hypertension?
17919235 2007 Urotensin II: a novel vasoactive mediator linked to chronic liver disease and portal hypertension.
17327028 2006 [Role of urotensin II gene in the genetic susceptibility to gestational diabetes mellitus in northern Chinese women].
16940699 2006 Human urotensin II as a link between hypertension and coronary artery disease.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...