Property Summary

NCBI Gene PubMed Count 12
PubMed Score 21.54
PubTator Score 34.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 0.7

Expression

Gene RIF (7)

AA Sequence

MNKILSSTVCFGLLTLLSVLSFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLA      1 - 70
LPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV                          71 - 119
//

Text Mined References (13)

PMID Year Title