Property Summary

NCBI Gene PubMed Count 9
PubMed Score 12.14
PubTator Score 15.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q75WM6 Q147U8 Q5GKZ5 Q7Z694
Symbols H1.7
H1T2

Gene

Gene RIF (2)

PMID Text
16533358 h-HANP1 is expressed in the testes and its genomic construct also intronless as mouse Hanp1. We found that the h-HANP1 coding region have 5 single-nucleotide polymorphisms in Japanese men.
15710904 H1T2 is a protein required for proper cell restructuring and DNA condensation during the elongation phase of spermiogenesis.

AA Sequence

MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVLQAIST      1 - 70
HKGLTLAALKKELRNAGYEVRRKSGRHEAPRGQAKATLLRVSGSDAAGYFRVWKVPKPRRKPGRARQEEG     71 - 140
TRAPWRTPAAPRSSRRRRQPLRKAARKAREVWRRNARAKAKANARARRTRRARPRAKEPPCARAKEEAGA    141 - 210
TAADEGRGQAVKEDTTPRSGKDKRRSSKPREEKQEPKKPAQRTIQ                             211 - 255
//

Text Mined References (11)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
24781148 2014 Histone variants: key players of chromatin.
24614311 2014 Every amino acid matters: essential contributions of histone variants to mammalian development and disease.
22650316 2012 A unified phylogeny-based nomenclature for histone variants.
21630459 2011 Proteomic characterization of the human sperm nucleus.
16541075 2006 The finished DNA sequence of human chromosome 12.
16533358 2006 Expression profiles and single-nucleotide polymorphism analysis of human HANP1/H1T2 encoding a histone H1-like protein.
16055721 2005 HANP1/H1T2, a novel histone H1-like protein involved in nuclear formation and sperm fertility.
15710904 2005 Polar nuclear localization of H1T2, a histone H1 variant, required for spermatid elongation and DNA condensation during spermiogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...