Property Summary

NCBI Gene PubMed Count 9
PubMed Score 12.14
PubTator Score 15.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q75WM6 Q147U8 Q5GKZ5 Q7Z694
Symbols H1.7
H1T2

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG
Pig OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
16533358 h-HANP1 is expressed in the testes and its genomic construct also intronless as mouse Hanp1. We found that the h-HANP1 coding region have 5 single-nucleotide polymorphisms in Japanese men.
15710904 H1T2 is a protein required for proper cell restructuring and DNA condensation during the elongation phase of spermiogenesis.

AA Sequence

MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVLQAIST      1 - 70
HKGLTLAALKKELRNAGYEVRRKSGRHEAPRGQAKATLLRVSGSDAAGYFRVWKVPKPRRKPGRARQEEG     71 - 140
TRAPWRTPAAPRSSRRRRQPLRKAARKAREVWRRNARAKAKANARARRTRRARPRAKEPPCARAKEEAGA    141 - 210
TAADEGRGQAVKEDTTPRSGKDKRRSSKPREEKQEPKKPAQRTIQ                             211 - 255
//

Text Mined References (11)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
24781148 2014 Histone variants: key players of chromatin.
24614311 2014 Every amino acid matters: essential contributions of histone variants to mammalian development and disease.
22650316 2012 A unified phylogeny-based nomenclature for histone variants.
21630459 2011 Proteomic characterization of the human sperm nucleus.
16541075 2006 The finished DNA sequence of human chromosome 12.
16533358 2006 Expression profiles and single-nucleotide polymorphism analysis of human HANP1/H1T2 encoding a histone H1-like protein.
16055721 2005 HANP1/H1T2, a novel histone H1-like protein involved in nuclear formation and sperm fertility.
15710904 2005 Polar nuclear localization of H1T2, a histone H1 variant, required for spermatid elongation and DNA condensation during spermiogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...