Property Summary

NCBI Gene PubMed Count 61
PubMed Score 0.00
PubTator Score 29.49

Knowledge Summary

Patent

No data available

Gene RIF (50)

PMID Text
26837962 MIR17HG gene expression is dysregulated in gastric cancer.
26545119 vFLIP and vCyclin induce the oncogenic miR-17-92 cluster in endothelial cells
26360630 Germline heterozygous deletions of MIR17HG is associated with feingold syndrome-2.
26233958 Our findings demonstrate an important role of the miR-17-92 cluster in hepatocarcinogenesis and suggest the possibility of targeting this pivotal miRNA cluster for potential therapy.
25887381 Our findings identify the miR-17-92 cluster as a functionally determining family of miRNAs in pancreatic cancer stem cells, and highlight the putative potential of developing modulators of this cluster to overcome drug resistance in pancreatic CSCs.
25870038 Functional interactions among members of the miR-17-92 cluster in lymphocyte development, differentiation and malignant transformation
25732734 WEE1 is a valid target of the miR-17-92 cluster in leukemia.
25634356 The oncogenic miR-17-92 cluster is involved in cutaneous B-cell lymphoma progression.
25415674 The current results of our study support a relationship between the miR-17-92 family and lipid metabolism
25359779 STAT3 activation is related to the up-regulation of miR-17-92 clusters in retinoblastoma cells via positive feedback loop between them
More...

AA Sequence

MFCHVDVKISSKRYTWTKLPLNVPKLVLIYLQSHFVLFFFSMCQSIWERPAIGRATTSSASWMVGYDCLL      1 - 70
//

Text Mined References (63)

PMID Year Title
26837962 miR-17-92 host gene, uderexpressed in gastric cancer and its expression was negatively correlated with the metastasis.
26545119 2015 Kaposi's Sarcoma-Associated Herpesvirus (KSHV) Induces the Oncogenic miR-17-92 Cluster and Down-Regulates TGF-? Signaling.
26360630 2015 Expanding the phenotype of feingold syndrome-2.
26233958 2015 MiR-17-92 cluster promotes hepatocarcinogenesis.
25887381 2015 The miR-17-92 cluster counteracts quiescence and chemoresistance in a distinct subpopulation of pancreatic cancer stem cells.
25870038 2015 Functional interactions among members of the miR-17-92 cluster in lymphocyte development, differentiation and malignant transformation.
25732734 2015 WEE1 is a validated target of the microRNA miR-17-92 cluster in leukemia.
25634356 2015 The High Expression of the microRNA 17-92 Cluster and its Paralogs, and the Downregulation of the Target Gene PTEN, Is Associated with Primary Cutaneous B-Cell Lymphoma Progression.
25415674 2014 Association of plasma MiR-17-92 with dyslipidemia in patients with coronary artery disease.
25359779 2014 STAT3 inhibition suppresses proliferation of retinoblastoma through down-regulation of positive feedback loop of STAT3/miR-17-92 clusters.
More...