Property Summary

NCBI Gene PubMed Count 76
PubMed Score 0.00
PubTator Score 29.49

Knowledge Summary

Patent

No data available

Gene RIF (62)

AA Sequence

MFCHVDVKISSKRYTWTKLPLNVPKLVLIYLQSHFVLFFFSMCQSIWERPAIGRATTSSASWMVGYDCLL      1 - 70
//

Text Mined References (78)

PMID Year Title