Property Summary

NCBI Gene PubMed Count 19
PubMed Score 13.99
PubTator Score 10.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma 1.100 6.2e-05
group 4 medulloblastoma 1.400 5.7e-05
hepatocellular carcinoma 1.300 1.2e-04
medulloblastoma, large-cell 1.100 3.9e-03
osteosarcoma -1.390 6.9e-04
ovarian cancer 1.200 1.2e-02
pediatric high grade glioma 1.400 2.3e-06
Rheumatoid arthritis 1.100 3.3e-02
tuberculosis -1.100 6.8e-04

Gene RIF (9)

AA Sequence

MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEER      1 - 70
YDCKGGELFANQRRFPGHLFWDFQINILGEKDDTPVHFCDKCGLPIKIYGRMIPCKHVFCYDCAILHEKK     71 - 140
GDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRAGKPVTRASLENVHPPIA    141 - 210
PPPTEIPERFIMPPDKHHMSHIPPKQHIMMPPPPLQHVPHEHYNQPHEDIRAPPAELSMAPPPPRSVSQE    211 - 280
TFRISTRKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPP    281 - 350
ISHPMPHPPQAAGTPHLVYSQAPPPPMTSAPPPITPPPGHIIAQMPPYMNHPPPGPPPPQHGGPPVTAPP    351 - 420
PHHYNPNSLPQFTEDQGTLSPPFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHHPDQTRYRPYY    421 - 490
Q//

Text Mined References (25)

PMID Year Title