Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.83
PubTator Score 10.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.033
hepatocellular carcinoma 1.300 0.000
osteosarcoma -1.390 0.001
glioblastoma 1.400 0.000
group 4 medulloblastoma 1.400 0.000
medulloblastoma, large-cell 1.100 0.004
tuberculosis and treatment for 6 months 1.300 0.000
pediatric high grade glioma 1.400 0.000
ovarian cancer 1.200 0.012

Synonym

Accession Q75N03 B7ZM03 Q8TAJ4 Q9H5S6
Symbols HAKAI
RNF188

Gene

PANTHER Protein Class (1)

Gene RIF (8)

PMID Text
25074933 these observations suggest that the dimeric architecture of the HYB domain is essential for the phosphotyrosine-binding property of Hakai.
23285092 By lowering Hakai abundance, miR-203 also reduces Hakai-regulated-cell division.
22252131 Hakai dimerization allows the formation of a phosphotyrosine-binding pocket that recognizes specific phosphorylated tyrosines and flanking acidic amino acids of Src substrates, such as E-cadherin, cortactin and DOK1.
21283129 Hakai mediates E-cadherin ubiquitination and degradation triggered by Slit-Robo signaling during colorectal epithelial cell carcinogenesis.
21191016 Together, these data do not support a requirement for CBLL1 during flavivirus entry and rather suggest an essential role of the ubiquitin/proteasome pathway for flavivirus genome amplification.
20608937 Results suggest that Hakai is a novel corepressor of ERalpha and may play a negative role in the development and progression of breast cancers.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19535458 Results suggest that Hakai is an important regulator of cell proliferation and that Hakai may be an oncoprotein and a potential molecular target for cancer treatment.

AA Sequence

MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEER      1 - 70
YDCKGGELFANQRRFPGHLFWDFQINILGEKDDTPVHFCDKCGLPIKIYGRMIPCKHVFCYDCAILHEKK     71 - 140
GDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRAGKPVTRASLENVHPPIA    141 - 210
PPPTEIPERFIMPPDKHHMSHIPPKQHIMMPPPPLQHVPHEHYNQPHEDIRAPPAELSMAPPPPRSVSQE    211 - 280
TFRISTRKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPP    281 - 350
ISHPMPHPPQAAGTPHLVYSQAPPPPMTSAPPPITPPPGHIIAQMPPYMNHPPPGPPPPQHGGPPVTAPP    351 - 420
PHHYNPNSLPQFTEDQGTLSPPFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHHPDQTRYRPYY    421 - 490
Q//

Text Mined References (23)

PMID Year Title
25074933 2014 Dimeric switch of Hakai-truncated monomers during substrate recognition: insights from solution studies and NMR structure.
24100041 2013 Identification of Wilms' tumor 1-associating protein complex and its role in alternative splicing and the cell cycle.
23285092 2012 miR-203 regulates cell proliferation through its influence on Hakai expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22252131 2012 Structure of a novel phosphotyrosine-binding domain in Hakai that targets E-cadherin.
21283129 2011 Slit-Robo signaling induces malignant transformation through Hakai-mediated E-cadherin degradation during colorectal epithelial cell carcinogenesis.
21191016 2011 Appraising the roles of CBLL1 and the ubiquitin/proteasome system for flavivirus entry and replication.
20608937 2010 Hakai acts as a coregulator of estrogen receptor alpha in breast cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...