Property Summary

NCBI Gene PubMed Count 2
PubMed Score 3.17

Knowledge Summary

Patent

No data available

AA Sequence

MDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFIWNGEVSPNLFE      1 - 70
EIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKQD     71 - 140
EL                                                                        141 - 142
//

Text Mined References (5)

PMID Year Title