Knowledge Summary

Patent

No data available

Synonym

Accession Q75L30 B2R4X6
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MATFPGQVSTYFLAAWTGPGPATHWPLYAQLMPHSGLSRPSSCPGTSSPGPKLPQVGLSRPSCCLPAFSP      1 - 70
GLALPPGCIYKTNSCLTTTFYGSAPAQLLPAFVGPKLPQVKLFRPTFCLAVACTDPALA                71 - 129
//

Text Mined References (3)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.