Knowledge Summary

Patent

No data available

Synonym

Accession Q75L30 B2R4X6
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MATFPGQVSTYFLAAWTGPGPATHWPLYAQLMPHSGLSRPSSCPGTSSPGPKLPQVGLSRPSCCLPAFSP      1 - 70
GLALPPGCIYKTNSCLTTTFYGSAPAQLLPAFVGPKLPQVKLFRPTFCLAVACTDPALA                71 - 129
//

Text Mined References (3)

PMID Year Title