Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.80
PubTator Score 5.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 4.8791757641961E-30
astrocytoma 1493 3.4054601580288E-19
oligodendroglioma 2849 3.71626783689919E-15
pilocytic astrocytoma 3086 7.32346161478062E-9
ovarian cancer 8492 7.30098299344829E-8
atypical teratoid/rhabdoid tumor 1095 8.48465134054936E-8
malignant mesothelioma 3163 1.16355175387179E-7
posterior fossa group A ependymoma 1511 1.79078576231885E-7
acute quadriplegic myopathy 1157 1.68079116105942E-6
pediatric high grade glioma 2712 1.28777271928654E-4
osteosarcoma 7933 1.39156908638124E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 8.26459130926291E-4
hereditary spastic paraplegia 313 0.00416280117294051
Multiple myeloma 1328 0.00515689332346146
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00645849427170602
Polycystic Ovary Syndrome 335 0.0101824365832482
subependymal giant cell astrocytoma 2287 0.0208093381822529
Disease Target Count Z-score Confidence
Shwachman-Diamond syndrome 16 3.809 1.9

Expression

Synonym

Accession Q71UM5 Q9BTJ1
Symbols

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
23826192 Elevated RPS27L may improve the prognoses of certain colorectal cancer patients by enhancing the DNA repair capacity of their colonic cells.

AA Sequence

MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGK      1 - 70
ARLTEGCSFRRKQH                                                             71 - 84
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23826192 2013 Ribosomal protein S27-like in colorectal cancer: a candidate for predicting prognoses.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
21170087 2011 Ribosomal protein S27-like and S27 interplay with p53-MDM2 axis as a target, a substrate and a regulator.
18056458 2007 Ribosomal protein S27-like, a p53-inducible modulator of cell fate in response to genotoxic stress.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17057733 2007 Ribosomal protein S27L is a direct p53 target that regulates apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...