Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.07
PubTator Score 5.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (1)

AA Sequence

MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGK      1 - 70
ARLTEGCSFRRKQH                                                             71 - 84
//

Text Mined References (11)

PMID Year Title