Property Summary

NCBI Gene PubMed Count 80
Grant Count 6
R01 Count 6
Funding $520,125
PubMed Score 35.24
PubTator Score 46.81

Knowledge Summary

Patent

No data available

Expression

Gene RIF (55)

PMID Text
26493046 data suggest that the TUBA1A mutations disrupting lateral interactions have pronounced dominant-negative effects on microtubule dynamics that are associated with the severe end of the lissencephaly spectrum
26307527 Data show that plasma membrane Ca(2+)-ATPase (PMCA) was associated with tubulin in normotensive and hypertensive erythrocytes.
26227334 Studies indicate that alpha-tubulin acetylation and microtubule level is mainly governed by opposing actions of alpha-tubulin acetyltransferase 1 (ATAT1) and histone deacetylase 6 (HDAC6).
26165356 Data show that tubulin phosphorylation and acetylation play important roles in the control of microtubule assembly and stability.
26161965 Data suggest that tubulin functionally interact with the vimentin network in a cell-type specific manner.
25602620 Data from studies using peptide fragment of alpha-tubulin (residues 31-49) suggest that Ser38 is crucial for substrate recognition by alpha-tubulin acetylase 1 (ATAT1); Asp39, Ile42, the glycine stretch (residues 43-45), and Asp46 are also involved.
25328666 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
25059107 This study show all foetuses with lissencephaly and cerebellar hypoplasia carried distinct TUBA1A mutations.
24940781 Lysine 40 acetylation of alpha-tubulin does not result in significant changes in kinesin-1's landing rate or motility parameters.
24914767 These results demonstrated that SelP interacts with tubulin, alpha 1a (TUBA1A).
More...

AA Sequence

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL      1 - 70
EPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHS     71 - 140
FGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY    141 - 210
DICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK    211 - 280
AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG    281 - 350
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE    351 - 420
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY                                           421 - 451
//

Text Mined References (88)

PMID Year Title
26972003 2016 ?-Tubulin Tyrosination and CLIP-170 Phosphorylation Regulate the Initiation of Dynein-Driven Transport in Neurons.
26968983 2016 Tyrosination of ?-tubulin controls the initiation of processive dynein-dynactin motility.
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
26493046 2015 TUBA1A mutation can cause a hydranencephaly-like severe form of cortical dysgenesis.
26307527 2015 PMCA activity and membrane tubulin affect deformability of erythrocytes from normal and hypertensive human subjects.
26227334 2015 Tubulin acetylation: responsible enzymes, biological functions and human diseases.
26165356 2015 Proteomic Profiling and Functional Characterization of Multiple Post-Translational Modifications of Tubulin.
26161965 2015 Co-Orientation: Quantifying Simultaneous Co-Localization and Orientational Alignment of Filaments in Light Microscopy.
25908662 2015 Mitosis. Microtubule detyrosination guides chromosomes during mitosis.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
More...