Property Summary

NCBI Gene PubMed Count 32
PubMed Score 55.95
PubTator Score 248.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.175 1.0e-04
intraductal papillary-mucinous neoplasm ... 1.300 2.2e-03
ovarian cancer 2.000 3.4e-07
pituitary cancer 1.100 5.9e-06

Gene RIF (19)

PMID Text
26130716 A model is proposed in which the N-terminal transactivation domain of ERM binds the MED25 VP16 H1 binding pocket in a helical conformation.
25792360 Homozygous MED25 mutation implicated in eye-intellectual disability syndrome.
25527630 the critical region of chromosome 19 a homozygous variant (c.418C>T, p.Arg140Trp) in Mediator complex subunit 25 predicted as deleterious.
25391650 MED25 is important for regulating the epigenetic landscape resulting in transcriptional activation of a highly inducible gene, CYP2C9
24960263 Med25 is identified as a new coactivator of ERalpha that is required for ERalpha-mediated regulation of CYP2C9 expression
23864652 Mediator subunit MED25 plays a critical role in this process and identify a MED25 domain that serves as a docking site on Mediator for the ATF6alpha transcription activation domain.
22952853 the identification of MED25 as one of the HNF4alpha binding partners in pancreatic ss-cells leading to insulin secretion which is impaired in MODY patients
21785987 solution NMR structure of protein MED25(391-543), comprising the activator interacting domain of subunit 25 of mediator, is presented with the measurement of polypeptide backbone heteronuclear 15N-{1H} NOEs to identify fast internal motional modes
21427722 The regulatory interaction between Sox9, Wwp2 and Med25 defines the Sox9 transcriptional mechanisms of chondrogenesis in the forming palate.
21378965 report the NMR structure of the Mediator subunit Med25 (also called Arc92) activator interaction domain (ACID) and analyze the structural and functional interaction of ACID with the archetypical acidic transcription activator VP16
21378963 A hydrophobic furrow, formed by a beta-barrel and two alpha-helices in MED25 VBD, interacts tightly with VP16 TADn
21135126 These results define a role for Med25 and the Mediator complex in the regulation of xenobiotic metabolism and lipid homeostasis.
21110951 MED25 and PTOV1 differentially modulate retinoic acid sensitivity in cancer cells depending on their expression levels.
20974256 Preliminary NMR chemical shift mapping showed that VP16 H2 (VP16C) interacts with MED25 ACID through one face of the beta-barrel, defined by strands B4-B7-B6.
20089804 Lana-1-induced serum response element activation was inhibited by the dominant-negative N-terminal domain of the human MED25 mediator subunit, suggesting that this subunit mediates Lana-1-induced serum response element activation.
19290556 Data show that Med25 is coordinately expressed with Pmp22 gene dosage and expression in transgenic mice and rats, and suggest a potential role of this protein in the molecular etiology of Charcot-Marie-Tooth disease.
17641689 data suggest that MED25, in cooperation with CBP and Mediators through its distinct domains, imposes a selective advantage on RAR/RXR activation
14983011 biochemical purification and cloning of ARC92; identified as a specific cellular interaction partner of the VP16 activation domain
12163014 cloned a prostate-derived cDNA encoding a novel protein with a predicted molecular weight of 78 kDa (P(78)), and precisely mapped the cDNA sequence to chromosome 19

AA Sequence

MVPGSEGPARAGSVVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVV      1 - 70
FNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHR     71 - 140
VCLLICNSPPYLLPAVESTTYSGCTTENLVQQIGERGIHFSIVSPRKLPALRLLFEKAAPPALLEPLQPP    141 - 210
TDVSQDPRHMVLVRGLVLPVGGGSAPGPLQSKQPVPLPPAAPSGATLSAAPQQPLPPVPPQYQVPGNLSA    211 - 280
AQVAAQNAVEAAKNQKAGLGPRFSPITPLQQAAPGVGPPFSQAPAPQLPPGPPGAPKPPPASQPSLVSTV    281 - 350
APGSGLAPTAQPGAPSMAGTVAPGGVSGPSPAQLGAPALGGQQSVSNKLLAWSGVLEWQEKPKPASVDAN    351 - 420
TKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIM    421 - 490
GNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQQRGMG    491 - 560
GQQAPPGLGPILEDQARPSQNLLQLRPPQPQPQGTVGASGATGQPQPQGTAQPPPGAPQGPPGAASGPPP    561 - 630
PGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPP    631 - 700
AQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI                           701 - 747
//

Text Mined References (34)

PMID Year Title
26130716 2015 Characterization of ERM transactivation domain binding to the ACID/PTOV domain of the Mediator subunit MED25.
25792360 2015 Homozygous MED25 mutation implicated in eye-intellectual disability syndrome.
25527630 2015 Homozygous missense mutation in MED25 segregates with syndromic intellectual disability in a large consanguineous family.
25391650 2015 Epigenetic modification of histone 3 lysine 27: mediator subunit MED25 is required for the dissociation of polycomb repressive complex 2 from the promoter of cytochrome P450 2C9.
24960263 2014 Med25 is required for estrogen receptor alpha (ER?)-mediated regulation of human CYP2C9 expression.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
23864652 2013 Role for human mediator subunit MED25 in recruitment of mediator to promoters by endoplasmic reticulum stress-responsive transcription factor ATF6?.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
22952853 2012 MED25 is a mediator component of HNF4?-driven transcription leading to insulin secretion in pancreatic beta-cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21785987 2011 Solution NMR structure of MED25(391-543) comprising the activator-interacting domain (ACID) of human mediator subunit 25.
21427722 2011 Wwp2 is essential for palatogenesis mediated by the interaction between Sox9 and mediator subunit 25.
21378965 2011 Structure and VP16 binding of the Mediator Med25 activator interaction domain.
21378963 2011 Structure of the VP16 transactivator target in the Mediator.
21135126 2011 Med25 is required for RNA polymerase II recruitment to specific promoters, thus regulating xenobiotic and lipid metabolism in human liver.
21110951 2011 PTOV1 antagonizes MED25 in RAR transcriptional activation.
20974256 2011 NMR structure of the human Mediator MED25 ACID domain.
20089804 2010 Kaposi's sarcoma-associated herpesvirus Lana-1 is a major activator of the serum response element and mitogen-activated protein kinase pathways via interactions with the Mediator complex.
19290556 2009 Identification of the variant Ala335Val of MED25 as responsible for CMT2B2: molecular data, functional studies of the SH3 recognition motif and correlation between wild-type MED25 and PMP22 RNA levels in CMT1A animal models.
17641689 2007 MED25 is distinct from TRAP220/MED1 in cooperating with CBP for retinoid receptor activation.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14983011 2004 The activator-recruited cofactor/Mediator coactivator subunit ARC92 is a functionally important target of the VP16 transcriptional activator.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657022 2003 A novel docking site on Mediator is critical for activation by VP16 in mammalian cells.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163014 2002 A prostate-derived cDNA that is mapped to human chromosome 19 encodes a novel protein.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11112660 2001 A second locus for an axonal form of autosomal recessive Charcot-Marie-Tooth disease maps to chromosome 19q13.3.
10235267 1999 Composite co-activator ARC mediates chromatin-directed transcriptional activation.
9110174 1997 Large-scale concatenation cDNA sequencing.