Property Summary

NCBI Gene PubMed Count 32
Grant Count 23
R01 Count 20
Funding $2,949,983.74
PubMed Score 55.95
PubTator Score 248.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.175 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.002
ovarian cancer 2.000 0.000
pituitary cancer 1.100 0.000

Gene RIF (19)

PMID Text
26130716 A model is proposed in which the N-terminal transactivation domain of ERM binds the MED25 VP16 H1 binding pocket in a helical conformation.
25792360 Homozygous MED25 mutation implicated in eye-intellectual disability syndrome.
25527630 the critical region of chromosome 19 a homozygous variant (c.418C>T, p.Arg140Trp) in Mediator complex subunit 25 predicted as deleterious.
25391650 MED25 is important for regulating the epigenetic landscape resulting in transcriptional activation of a highly inducible gene, CYP2C9
24960263 Med25 is identified as a new coactivator of ERalpha that is required for ERalpha-mediated regulation of CYP2C9 expression
23864652 Mediator subunit MED25 plays a critical role in this process and identify a MED25 domain that serves as a docking site on Mediator for the ATF6alpha transcription activation domain.
22952853 the identification of MED25 as one of the HNF4alpha binding partners in pancreatic ss-cells leading to insulin secretion which is impaired in MODY patients
21785987 solution NMR structure of protein MED25(391-543), comprising the activator interacting domain of subunit 25 of mediator, is presented with the measurement of polypeptide backbone heteronuclear 15N-{1H} NOEs to identify fast internal motional modes
21427722 The regulatory interaction between Sox9, Wwp2 and Med25 defines the Sox9 transcriptional mechanisms of chondrogenesis in the forming palate.
21378965 report the NMR structure of the Mediator subunit Med25 (also called Arc92) activator interaction domain (ACID) and analyze the structural and functional interaction of ACID with the archetypical acidic transcription activator VP16
More...

AA Sequence

MVPGSEGPARAGSVVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVV      1 - 70
FNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHR     71 - 140
VCLLICNSPPYLLPAVESTTYSGCTTENLVQQIGERGIHFSIVSPRKLPALRLLFEKAAPPALLEPLQPP    141 - 210
TDVSQDPRHMVLVRGLVLPVGGGSAPGPLQSKQPVPLPPAAPSGATLSAAPQQPLPPVPPQYQVPGNLSA    211 - 280
AQVAAQNAVEAAKNQKAGLGPRFSPITPLQQAAPGVGPPFSQAPAPQLPPGPPGAPKPPPASQPSLVSTV    281 - 350
APGSGLAPTAQPGAPSMAGTVAPGGVSGPSPAQLGAPALGGQQSVSNKLLAWSGVLEWQEKPKPASVDAN    351 - 420
TKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIM    421 - 490
GNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQQRGMG    491 - 560
GQQAPPGLGPILEDQARPSQNLLQLRPPQPQPQGTVGASGATGQPQPQGTAQPPPGAPQGPPGAASGPPP    561 - 630
PGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPP    631 - 700
AQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI                           701 - 747
//

Text Mined References (34)

PMID Year Title
26130716 2015 Characterization of ERM transactivation domain binding to the ACID/PTOV domain of the Mediator subunit MED25.
25792360 2015 Homozygous MED25 mutation implicated in eye-intellectual disability syndrome.
25527630 2015 Homozygous missense mutation in MED25 segregates with syndromic intellectual disability in a large consanguineous family.
25391650 2015 Epigenetic modification of histone 3 lysine 27: mediator subunit MED25 is required for the dissociation of polycomb repressive complex 2 from the promoter of cytochrome P450 2C9.
24960263 2014 Med25 is required for estrogen receptor alpha (ER?)-mediated regulation of human CYP2C9 expression.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
23864652 2013 Role for human mediator subunit MED25 in recruitment of mediator to promoters by endoplasmic reticulum stress-responsive transcription factor ATF6?.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
22952853 2012 MED25 is a mediator component of HNF4?-driven transcription leading to insulin secretion in pancreatic beta-cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...