Property Summary

NCBI Gene PubMed Count 28
PubMed Score 43.87
PubTator Score 32.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Gene RIF (24)

AA Sequence

MQTKGGQTWARRALLLGILWATAHLPLSGTSLPQRLPRATGNSTQCVISPSSEFPEGFFTRQERRDGGII      1 - 70
IYFLIIVYMFMAISIVCDEYFLPSLEIISESLGLSQDVAGTTFMAAGSSAPELVTAFLGVFITKGDIGIS     71 - 140
TILGSAIYNLLGICAACGLLSNTVSTLSCWPLFRDCAAYTISAAAVLGIIYDNQVYWYEGALLLLIYGLY    141 - 210
VLVLCFDIKINQYIIKKCSPCCACLAKAMERSEQQPLMGWEDEGQPFIRRQSRTDSGIFYEDSGYSQLSI    211 - 280
SLHGLSQVSEDPPSVFNMPEADLKRIFWVLSLPIITLLFLTTPDCRKKFWKNYFVITFFMSAIWISAFTY    281 - 350
ILVWMVTITGETLEIPDTVMGLTLLAAGTSIPDTIASVLVARKGKGDMAMSNIVGSNVFDMLCLGIPWFI    351 - 420
KTAFINGSAPAEVNSRGLTYITISLNISIIFLFLAVHFNGWKLDRKLGIVCLLSYLGLATLSVLYELGII    421 - 490
GNNKIRGCGG                                                                491 - 500
//

Text Mined References (29)

PMID Year Title