Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.62
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.11544922969439E-11
juvenile dermatomyositis 1189 8.17781492738746E-11
atypical teratoid / rhabdoid tumor 4369 8.47089807309624E-7
ovarian cancer 8492 1.793970707012E-5
pilocytic astrocytoma 3086 3.08257676387601E-5
glioblastoma 5572 3.13793133027881E-5
adult high grade glioma 2148 4.35878425945227E-5

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group A ependymoma -1.600 0.000
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
juvenile dermatomyositis -1.050 0.000
adult high grade glioma -1.600 0.000
pilocytic astrocytoma -1.100 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q71RH2 Q9H0J1
Symbols FP1188

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MLTPMVAGGVVFPGLFLLSKNTLQRLPQLRWEEADAVIVSARLVSSVQAIMASTAGYIVSTSCKHIIDDQ      1 - 70
HWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGDDGAARAPGSTWAIARGYLHKEFLMVLHHAAMV     71 - 140
LVCFPLSVVWRQGKGDFFLGCMLMAEVSTPFVCLGKILIQYKQQHTLLHKVNGALMLLSFLCCRVLLFPY    141 - 210
LYWAYGRHAGLPLLAVPLAIPAHVNLGAALLLAPQLYWFFLICRGACRLFWPRSRPPPACQAQD          211 - 274
//

Text Mined References (13)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23275342 2013 Fam57b (family with sequence similarity 57, member B), a novel peroxisome proliferator-activated receptor ? target gene that regulates adipogenesis through ceramide synthesis.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
16381901 2006 The LIFEdb database in 2006.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...