Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.62
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group A ependymoma -1.600 0.000
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
juvenile dermatomyositis -1.050 0.000
adult high grade glioma -1.600 0.000
pilocytic astrocytoma -1.100 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q71RH2 Q9H0J1
Symbols FP1188

Gene

AA Sequence

MLTPMVAGGVVFPGLFLLSKNTLQRLPQLRWEEADAVIVSARLVSSVQAIMASTAGYIVSTSCKHIIDDQ      1 - 70
HWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGDDGAARAPGSTWAIARGYLHKEFLMVLHHAAMV     71 - 140
LVCFPLSVVWRQGKGDFFLGCMLMAEVSTPFVCLGKILIQYKQQHTLLHKVNGALMLLSFLCCRVLLFPY    141 - 210
LYWAYGRHAGLPLLAVPLAIPAHVNLGAALLLAPQLYWFFLICRGACRLFWPRSRPPPACQAQD          211 - 274
//

Text Mined References (13)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23275342 2013 Fam57b (family with sequence similarity 57, member B), a novel peroxisome proliferator-activated receptor ? target gene that regulates adipogenesis through ceramide synthesis.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
16381901 2006 The LIFEdb database in 2006.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...