Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.62
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.600 4.4e-05
Astrocytoma, Pilocytic -1.200 8.1e-06
atypical teratoid / rhabdoid tumor -1.600 8.5e-07
ependymoma -1.500 2.1e-10
glioblastoma -1.200 4.5e-06
juvenile dermatomyositis -1.050 8.2e-11
ovarian cancer -1.200 1.8e-05

AA Sequence

MLTPMVAGGVVFPGLFLLSKNTLQRLPQLRWEEADAVIVSARLVSSVQAIMASTAGYIVSTSCKHIIDDQ      1 - 70
HWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGDDGAARAPGSTWAIARGYLHKEFLMVLHHAAMV     71 - 140
LVCFPLSVVWRQGKGDFFLGCMLMAEVSTPFVCLGKILIQYKQQHTLLHKVNGALMLLSFLCCRVLLFPY    141 - 210
LYWAYGRHAGLPLLAVPLAIPAHVNLGAALLLAPQLYWFFLICRGACRLFWPRSRPPPACQAQD          211 - 274
//

Text Mined References (13)

PMID Year Title