Knowledge Summary

Patent

No data available

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MGTGGSLLCGCSLVLSCLCPSASLPDPGNSTWPPGAQAGLPAALALPLPRLPRILFPMAGRPARPSSDFV      1 - 70
GCAQGMCCHGRQGTVHIHTSSVSCWTPCPVTGTGGTAVSRKDRVLPHRRQVSLACVCAVGERAGQLWSQK     71 - 140
PVQMARPSARHLLPRGSSPNSQAVLLPSVCPVPWPPVGPSPGQGEGLSPAFPGVGTDRGDSWALVLQV      141 - 208
//

Text Mined References (3)

PMID Year Title