Knowledge Summary

Patent

No data available

Synonym

Accession Q71RG6
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MGTGGSLLCGCSLVLSCLCPSASLPDPGNSTWPPGAQAGLPAALALPLPRLPRILFPMAGRPARPSSDFV      1 - 70
GCAQGMCCHGRQGTVHIHTSSVSCWTPCPVTGTGGTAVSRKDRVLPHRRQVSLACVCAVGERAGQLWSQK     71 - 140
PVQMARPSARHLLPRGSSPNSQAVLLPSVCPVPWPPVGPSPGQGEGLSPAFPGVGTDRGDSWALVLQV      141 - 208
//

Text Mined References (3)

PMID Year Title
22586462 2012 3D profile-based approach to proteome-wide discovery of novel human chemokines.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.