Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 6.8e-09
psoriasis 6694 1.4e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.408 6.8e-09
psoriasis -1.600 1.4e-04

AA Sequence

MISRHLQNNLMSVDPASSQAMELSDVTLIEGVGNEVMVVAGVVVLILALVLAWLSTYVADSGSNQLLGAI      1 - 70
VSAGDTSVLHLGHVDHLVAGQGNPEPTELPHPSEGNDEKAEEAGEGRGDSTGEAGAGGGVEPSLEHLLDI     71 - 140
QGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQ    141 - 210
MKLIYQGRLLQDPARTLRSLNITDNCVIHCHRSPPGSAVPGPSASLAPSATEPPSLGVNVGSLMVPVFVV    211 - 280
LLGVVWYFRINYRQFFTAPATVSLVGVTVFFSFLVFGMYGR                                 281 - 321
//

Text Mined References (13)

PMID Year Title