Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.08
PubTator Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.40883074993606E-11
nasopharyngeal carcinoma 1056 1.61325842137108E-9
osteosarcoma 7933 6.96889728273565E-6
interstitial cystitis 2299 2.22603608695784E-4
pancreatic cancer 2300 5.44403807388049E-4
pancreatic carcinoma 567 5.44403807388056E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00108247916911246
diabetes mellitus 1663 0.0014972857788561
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00959414381813362

Expression

Synonym

Accession Q71RC9
Symbols PP12104
C17orf109

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG

AA Sequence

MAATDFVQEMRAVGERLLLKLQRLPQAEPVEIVAFSVIILFTATVLLLLLIACSCCCTHCCCPERRGRKV      1 - 70
QVQPTPP                                                                    71 - 77
//

Text Mined References (5)

PMID Year Title
24318988 2014 FUT11 as a potential biomarker of clear cell renal cell carcinoma progression based on meta-analysis of gene expression data.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.