Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.08
PubTator Score 0.60

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAATDFVQEMRAVGERLLLKLQRLPQAEPVEIVAFSVIILFTATVLLLLLIACSCCCTHCCCPERRGRKV      1 - 70
QVQPTPP                                                                    71 - 77
//

Text Mined References (5)

PMID Year Title
24318988 2014 FUT11 as a potential biomarker of clear cell renal cell carcinoma progression based on meta-analysis of gene expression data.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.