Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.77
PubTator Score 1.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
breast carcinoma 1614 1.65285891866032E-19
osteosarcoma 7933 2.50650320286048E-7
glioblastoma 5572 3.49198236798373E-6
pediatric high grade glioma 2712 1.46938206088158E-5
atypical teratoid / rhabdoid tumor 4369 5.3656086359846E-5
medulloblastoma, large-cell 6234 1.01345595036853E-4
hepatocellular carcinoma 550 2.50011748222164E-4
primitive neuroectodermal tumor 3031 4.15537572907146E-4
ependymoma 2514 4.58939209751822E-4
ductal carcinoma in situ 1745 5.63956208219247E-4
group 4 medulloblastoma 1875 7.43402400012403E-4
pancreatic cancer 2300 0.00144678003732474
pancreatic carcinoma 567 0.00144678003732477
invasive ductal carcinoma 2950 0.00159117782753105
hereditary spastic paraplegia 313 0.00351639970063559
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00556097442090088
ovarian cancer 8492 0.00982668922276973
active Crohn's disease 918 0.0204062987895177
progressive supranuclear palsy 674 0.0225541782476332
lung cancer 4473 0.036505740867495
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.049478210780092

Expression

Synonym

Accession Q71RC2 A8K6T1 E9PDG5 G3XAA8 G5E976 Q5CZ97 Q6ZV14 Q96NF9
Symbols PP13296

Gene

PDB

2CQK   3PKN  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid

Gene RIF (5)

PMID Text
26644407 Involvement of LARP4 as a target of TNF-alpha-TTP regulation provides a clue as to how its functional activity may be used in a physiologic pathway.
23887937 The results demonstrate that the La modules of the human LARP4 is also active in tRNA-mediated suppression, even in the absence of stable UUU-3'OH trailer protection.
21098120 LARP4 activity is integrated with other PAM2 protein activities by PABP as part of mRNA homeostasis.
16682284 FISH study showed no cytogenetic abnormalities in any of the analyzed cases.
15572213 The c-MPL protein altered expression provide an opportunity to diagnose and identify subpopulations of MPD patients.

AA Sequence

MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEV      1 - 70
MYSSSCETTRNTTGIEESTDGMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRENLSKDL     71 - 140
YLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCIVILREIPETT    141 - 210
PIEEVKGLFKSENCPKVISCEFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAK    211 - 280
NGYRLMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNG    281 - 350
FNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNFPAERHNPTVTGH    351 - 420
QEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFPPLPGS    421 - 490
SSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQ    491 - 560
EKDLIEDSSVQKDGLNQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEP    561 - 630
SSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQRRQFS    631 - 700
HRAIPQGVTRRNGKEQYVPPRSPK                                                  701 - 724
//

Text Mined References (31)

PMID Year Title
26644407 2015 LARP4 Is Regulated by Tumor Necrosis Factor Alpha in a Tristetraprolin-Dependent Manner.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23887937 2013 Conservation of RNA chaperone activity of the human La-related proteins 4, 6 and 7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...