Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.61
PubTator Score 1.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.201 2.0e-02
adult high grade glioma 1.100 7.3e-03
atypical teratoid / rhabdoid tumor 1.700 9.5e-06
breast carcinoma 1.100 1.7e-19
ductal carcinoma in situ 1.200 5.6e-04
ependymoma 1.100 4.6e-04
glioblastoma 1.400 3.8e-05
group 4 medulloblastoma 1.100 6.3e-03
hepatocellular carcinoma 1.100 2.3e-06
hereditary spastic paraplegia -1.222 3.5e-03
intraductal papillary-mucinous neoplasm ... 1.200 4.9e-02
invasive ductal carcinoma 1.100 1.6e-03
lung cancer 1.100 3.7e-02
medulloblastoma, large-cell 2.000 6.9e-06
osteosarcoma 2.155 2.5e-07
ovarian cancer -1.100 4.9e-04
pancreatic cancer 1.200 1.4e-03
pancreatic carcinoma 1.200 1.4e-03
pancreatic ductal adenocarcinoma liver m... -1.168 5.6e-03
primitive neuroectodermal tumor 1.200 4.2e-04
progressive supranuclear palsy -1.100 2.3e-02

Gene RIF (6)

AA Sequence

MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEV      1 - 70
MYSSSCETTRNTTGIEESTDGMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRENLSKDL     71 - 140
YLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCIVILREIPETT    141 - 210
PIEEVKGLFKSENCPKVISCEFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAK    211 - 280
NGYRLMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNG    281 - 350
FNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNFPAERHNPTVTGH    351 - 420
QEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFPPLPGS    421 - 490
SSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQ    491 - 560
EKDLIEDSSVQKDGLNQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEP    561 - 630
SSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQRRQFS    631 - 700
HRAIPQGVTRRNGKEQYVPPRSPK                                                  701 - 724
//

Text Mined References (32)

PMID Year Title