Property Summary

NCBI Gene PubMed Count 6
Grant Count 4
R01 Count 4
Funding $531,392.33
PubMed Score 2.76
PubTator Score 0.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
posterior fossa group A ependymoma 1.300 0.000
glioblastoma 1.300 0.001
group 3 medulloblastoma -1.400 0.010
atypical teratoid/rhabdoid tumor 2.000 0.000
medulloblastoma, large-cell -1.800 0.001
tuberculosis -1.100 0.000
pilocytic astrocytoma 1.600 0.000
ovarian cancer -5.000 0.000

Synonym

Accession Q71H61
Symbols C1orf32
dJ782G3.1

Gene

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESL      1 - 70
GMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDS     71 - 140
GLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPEWVFVGLVLLGVFLFFVLVGICWCQ    141 - 210
CCPHSCCCYVRCPCCPDSCCCPQALYEAGKAAKAGYPPSVSGVPGPYSIPSVPLGGAPSSGMLMDKPHPP    211 - 280
PLAPSDSTGGSHSVRKGYRIQADKERDSMKVLYYVEKELAQFDPARRMRGRYNNTISELSSLHEEDSNFR    281 - 350
QSFHQMRSKQFPVSGDLESNPDYWSGVMGGSSGASRGPSAMEYNKEDRESFRHSQPRSKSEMLSRKNFAT    351 - 420
GVPAVSMDELAAFADSYGQRPRRADGNSHEARGGSRFERSESRAHSGFYQDDSLEEYYGQRSRSREPLTD    421 - 490
ADRGWAFSPARRRPAEDAHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQLGP    491 - 560
RSASYYAWSPPGTYKAGSSQDDQEDASDDALPPYSELELTRGPSYRGRDLPYHSNSEKKRKKEPAKKTND    561 - 630
FPTRMSLVV                                                                 631 - 639
//

Text Mined References (6)

PMID Year Title
25367360 2015 Genome-wide association study for refractive astigmatism reveals genetic co-determination with spherical equivalent refractive error: the CREAM consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.