Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.05
PubTator Score 0.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 1.0e-06
atypical teratoid / rhabdoid tumor 1.800 8.1e-05
ependymoma 1.200 5.7e-05
glioblastoma 1.300 6.3e-04
group 3 medulloblastoma -1.400 1.0e-02
medulloblastoma, large-cell -1.800 1.4e-03
ovarian cancer -5.000 2.8e-13
tuberculosis -1.100 1.9e-05

Gene RIF (4)

AA Sequence

MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESL      1 - 70
GMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDS     71 - 140
GLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPEWVFVGLVLLGVFLFFVLVGICWCQ    141 - 210
CCPHSCCCYVRCPCCPDSCCCPQALYEAGKAAKAGYPPSVSGVPGPYSIPSVPLGGAPSSGMLMDKPHPP    211 - 280
PLAPSDSTGGSHSVRKGYRIQADKERDSMKVLYYVEKELAQFDPARRMRGRYNNTISELSSLHEEDSNFR    281 - 350
QSFHQMRSKQFPVSGDLESNPDYWSGVMGGSSGASRGPSAMEYNKEDRESFRHSQPRSKSEMLSRKNFAT    351 - 420
GVPAVSMDELAAFADSYGQRPRRADGNSHEARGGSRFERSESRAHSGFYQDDSLEEYYGQRSRSREPLTD    421 - 490
ADRGWAFSPARRRPAEDAHLPRLVSRTPGTAPKYDHSYLGSARERQARPEGASRGGSLETPSKRSAQLGP    491 - 560
RSASYYAWSPPGTYKAGSSQDDQEDASDDALPPYSELELTRGPSYRGRDLPYHSNSEKKRKKEPAKKTND    561 - 630
FPTRMSLVV                                                                 631 - 639
//

Text Mined References (7)

PMID Year Title