Property Summary

NCBI Gene PubMed Count 24
Grant Count 5
Funding $412,059
PubMed Score 11.33
PubTator Score 14.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q71F23 A2RRD9 Q09GN2 Q32Q71 Q9H5G1 CENP-U
Symbols KLIP1
PBIP1
CENP50
MLF1IP
CENPU50

Gene

 GWAS Trait (1)

Gene RIF (9)

PMID Text
25670858 Plk1 regulates the timing of the delocalization and ultimate destruction of the PBIP1.CENP-Q complex.
25572810 MLF1IP significantly promotes prostate cancer cell proliferation and colony formation and significantly inhibits apoptosis without affecting cell cycle phase arrest in prostate cancer cell lines
23028590 Data propose that CENP-P/O/R/Q/U self-assembles on kinetochores with varying stoichiometry and undergoes a pre-mitotic maturation step that could be important for kinetochores switching into the correct conformation for microtubule-attachment.
21454580 Mammalian polo-like kinase 1-dependent regulation of the PBIP1-CENP-Q complex at kinetochores.
21056971 CENP-U is a novel microtubule binding protein and plays an important role in kinetochore-microtubule attachment through its interaction with Hec1
17595757 Deletion mutants of MLF1IP revealed that the N-terminal bipartite nuclear localization signal (NLS) was responsible for nucleolar targeting.
17081991 Plk1 self-regulates the Plk1-PBIP1 interaction to timely localize to the kinetochores and promote proper chromosome segregation.
15893739 MLF1IP was found in glioblastomas where it was co-localized with MLF1 and nestin. Moreover, it was elevated in the contralateral brain where no tumor cells occurred, suggesting a role in glioma pathogenesis and potentially in other types of malignancies.
15116101 a possible role for MLF1IP deregulation in the genesis of erythroleukemias

AA Sequence

MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNSDVSSIGRLGENEKDEETYET      1 - 70
FDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSE     71 - 140
SIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESVTSKKTGPLSAQPSVEKENLAIESQSKTQK    141 - 210
KGKISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIAT    211 - 280
FYVNVKEQFIKMLKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSS    281 - 350
LRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG      351 - 418
//

Text Mined References (31)

PMID Year Title
25670858 2015 Mammalian Polo-like kinase 1 (Plk1) promotes proper chromosome segregation by phosphorylating and delocalizing the PBIP1·CENP-Q complex from kinetochores.
25572810 2015 MLF1 interacting protein: a potential gene therapy target for human prostate cancer?
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028590 2012 Step-wise assembly, maturation and dynamic behavior of the human CENP-P/O/R/Q/U kinetochore sub-complex.
22446962 2012 A genome-wide association study identifies three new risk loci for Kawasaki disease.
21454580 2011 Mammalian polo-like kinase 1-dependent regulation of the PBIP1-CENP-Q complex at kinetochores.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21056971 2011 CENP-U cooperates with Hec1 to orchestrate kinetochore-microtubule attachment.
More...