Property Summary

NCBI Gene PubMed Count 26
PubMed Score 13.12
PubTator Score 14.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (33)

Disease log2 FC p
adrenocortical carcinoma 2.989 2.7e-07
adult high grade glioma 2.700 7.3e-05
astrocytoma 1.400 1.7e-07
atypical teratoid / rhabdoid tumor 3.300 8.1e-10
Breast cancer 4.200 2.2e-02
breast carcinoma 2.000 2.6e-07
colon cancer 1.600 1.4e-03
ductal carcinoma in situ 2.600 2.3e-03
Endometriosis 2.444 1.1e-02
ependymoma 1.900 9.4e-06
glioblastoma 3.600 1.6e-12
group 3 medulloblastoma 4.600 4.2e-10
interstitial cystitis 1.500 3.7e-02
intraductal papillary-mucinous adenoma (... 1.400 1.9e-03
intraductal papillary-mucinous carcinoma... 2.900 9.5e-05
intraductal papillary-mucinous neoplasm ... 3.400 2.7e-04
invasive ductal carcinoma 2.900 1.4e-03
lung adenocarcinoma 1.100 8.5e-05
lung cancer 2.500 2.8e-03
malignant mesothelioma 2.100 7.9e-08
medulloblastoma, large-cell 4.400 6.6e-08
Multiple myeloma 1.244 2.7e-02
nasopharyngeal carcinoma 1.600 1.2e-05
non-small cell lung cancer 2.760 7.0e-26
oligodendroglioma 1.600 2.8e-06
osteosarcoma -3.738 4.5e-07
ovarian cancer 1.400 3.6e-03
pancreatic cancer 1.900 6.7e-06
pancreatic ductal adenocarcinoma liver m... 1.564 2.9e-02
pituitary cancer 2.000 4.6e-05
primary Sjogren syndrome 1.100 4.7e-02
primitive neuroectodermal tumor 4.100 7.2e-07
psoriasis 1.200 1.6e-04

Protein-protein Interaction (6)

Gene RIF (11)

AA Sequence

MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNSDVSSIGRLGENEKDEETYET      1 - 70
FDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSE     71 - 140
SIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESVTSKKTGPLSAQPSVEKENLAIESQSKTQK    141 - 210
KGKISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIAT    211 - 280
FYVNVKEQFIKMLKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSS    281 - 350
LRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG      351 - 418
//

Text Mined References (34)

PMID Year Title