Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.25
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute quadriplegic myopathy 1.292 5.3e-06
adult high grade glioma 1.100 1.4e-03
astrocytic glioma 1.600 4.8e-03
Astrocytoma, Pilocytic 1.400 5.7e-07
atypical teratoid / rhabdoid tumor 2.000 4.7e-05
Breast cancer -1.200 1.8e-05
ependymoma 2.000 1.9e-02
gastric carcinoma 1.100 2.8e-02
glioblastoma 1.300 2.4e-05
group 3 medulloblastoma 1.400 4.4e-02
intraductal papillary-mucinous adenoma (... 1.800 5.2e-04
intraductal papillary-mucinous carcinoma... 1.100 3.3e-02
intraductal papillary-mucinous neoplasm ... 1.100 9.0e-03
juvenile dermatomyositis 1.120 2.8e-10
malignant mesothelioma 1.900 2.2e-07
medulloblastoma, large-cell 1.200 1.1e-04
non-small cell lung cancer -1.258 3.5e-11
oligodendroglioma 2.000 1.2e-02
osteosarcoma -2.982 3.6e-07
ovarian cancer -1.800 4.1e-05
pancreatic ductal adenocarcinoma liver m... 1.634 1.5e-02
Pick disease -1.600 6.1e-04
primitive neuroectodermal tumor 1.200 8.1e-03
progressive supranuclear palsy -1.700 1.8e-02
psoriasis -2.000 4.5e-08
tuberculosis 1.400 3.4e-06

AA Sequence

MAKWGQGNPHWIVEEREDGTNVNNWRWTERDATSLSKGKFQELLVGIVVENDAGRGEINELKQVEGEASC      1 - 70
SSRKGKLIFFYEWNIKLGWKGIVKESGVKHKGLIEIPNLSEENEVDDTEVSLSKKKGDGVILKDLMKTAG     71 - 140
TAKVREALGDYLKALKTEFTTGMILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMEL    141 - 210
FDTTVEQLYSIFTVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCW    211 - 280
QKQHFEEIKGSLQLTPLNG                                                       281 - 299
//

Text Mined References (14)

PMID Year Title