Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAKWGQGNPHWIVEEREDGTNVNNWRWTERDATSLSKGKFQELLVGIVVENDAGRGEINELKQVEGEASC      1 - 70
SSRKGKLIFFYEWNIKLGWKGIVKESGVKHKGLIEIPNLSEENEVDDTEVSLSKKKGDGVILKDLMKTAG     71 - 140
TAKVREALGDYLKALKTEFTTGMILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMEL    141 - 210
FDTTVEQLYSIFTVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCW    211 - 280
QKQHFEEIKGSLQLTPLNG                                                       281 - 299
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15570572 2005 Automated immobilized metal affinity chromatography/nano-liquid chromatography/electrospray ionization mass spectrometry platform for profiling protein phosphorylation sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14739935 2004 Structural basis for recruitment of the ATPase activator Aha1 to the Hsp90 chaperone machinery.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...