Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 3.53743149284233E-11
juvenile dermatomyositis 1189 2.82018612659736E-10
ovarian cancer 8492 1.45087595435638E-7
malignant mesothelioma 3163 2.2027970771891E-7
osteosarcoma 7933 3.64228418413757E-7
pilocytic astrocytoma 3086 1.72741379269092E-6
acute quadriplegic myopathy 1157 5.29691875416194E-6
Pick disease 1893 1.17143586934841E-5
Breast cancer 3099 1.78947051648511E-5
tuberculosis and treatment for 3 months 327 1.85756976887749E-5
glioblastoma 5572 2.35748500668299E-5
atypical teratoid / rhabdoid tumor 4369 4.66352311590683E-5
medulloblastoma, large-cell 6234 1.10088210090743E-4
primitive neuroectodermal tumor 3031 1.26736225096944E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.17745579386391E-4
adult high grade glioma 2148 0.00142822148676051
psoriasis 6685 0.00473142051422719
astrocytic glioma 2241 0.00481109070044008
progressive supranuclear palsy 674 0.0084102035425495
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00966858206405212
oligodendroglioma 2849 0.0117631532650271
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0121428845312224
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0151093156342761
ependymoma 2514 0.0186733867179702
gastric carcinoma 832 0.0279757619464665
group 3 medulloblastoma 2254 0.0444477321759125

Expression

Synonym

Accession Q719I0 B3KS51 D6W5E0 Q8NDU5
Symbols AHA1
Hch1

Gene

PANTHER Protein Class (1)

  Ortholog (5)

Species Source
Mouse EggNOG Inparanoid
Horse EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken EggNOG Inparanoid

AA Sequence

MAKWGQGNPHWIVEEREDGTNVNNWRWTERDATSLSKGKFQELLVGIVVENDAGRGEINELKQVEGEASC      1 - 70
SSRKGKLIFFYEWNIKLGWKGIVKESGVKHKGLIEIPNLSEENEVDDTEVSLSKKKGDGVILKDLMKTAG     71 - 140
TAKVREALGDYLKALKTEFTTGMILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMEL    141 - 210
FDTTVEQLYSIFTVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCW    211 - 280
QKQHFEEIKGSLQLTPLNG                                                       281 - 299
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15570572 2005 Automated immobilized metal affinity chromatography/nano-liquid chromatography/electrospray ionization mass spectrometry platform for profiling protein phosphorylation sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14739935 2004 Structural basis for recruitment of the ATPase activator Aha1 to the Hsp90 chaperone machinery.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...