Property Summary

NCBI Gene PubMed Count 14
Grant Count 10
R01 Count 5
Funding $2,580,350.67
PubMed Score 162.33
PubTator Score 93.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.800 0.002
ependymoma -1.200 0.043
oligodendroglioma -1.300 0.013
glioblastoma -1.900 0.001
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.300 0.007
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.500 0.003
non-small cell lung cancer 2.133 0.000
intraductal papillary-mucinous adenoma (... 1.600 0.001
interstitial cystitis -1.600 0.000
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -1.600 0.000
spina bifida -1.771 0.040
ductal carcinoma in situ 1.200 0.012
ovarian cancer 1.200 0.002

Gene RIF (5)

PMID Text
26334369 The authors find that the KCTD proteins 5, 6, 9 and 17 bind to Cul3 with high affinity, while the KCTD proteins 1 and 16 do not have detectable binding.
24736394 KCTD1 functions as a novel inhibitor of Wnt signaling p
23541344 Mutations in KCTD1 cause scalp-ear-nipple syndrome.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19115315 indicate the novel function of KCTD1 as the transcriptional repressor for AP-2 family, especially for AP-2alpha

AA Sequence

MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDS      1 - 70
LKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPC     71 - 140
ECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERL    141 - 210
QQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD                           211 - 257
//

Text Mined References (18)

PMID Year Title
26334369 2016 Structural Insights into KCTD Protein Assembly and Cullin3 Recognition.
25416956 2014 A proteome-scale map of the human interactome network.
24736394 2014 KCTD1 suppresses canonical Wnt signaling pathway by enhancing ?-catenin degradation.
23541344 2013 Mutations in KCTD1 cause scalp-ear-nipple syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19115315 2009 The interaction of KCTD1 with transcription factor AP-2alpha inhibits its transactivation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18358072 2008 Characterization and expression of a human KCTD1 gene containing the BTB domain, which mediates transcriptional repression and homomeric interactions.
More...