Property Summary

NCBI Gene PubMed Count 18
PubMed Score 183.11
PubTator Score 93.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.500 1.7e-04
astrocytic glioma -1.800 2.0e-03
Astrocytoma, Pilocytic -1.600 1.0e-07
atypical teratoid / rhabdoid tumor -1.300 7.4e-03
ductal carcinoma in situ 1.200 1.2e-02
ependymoma -1.200 4.3e-02
glioblastoma -1.500 7.0e-07
group 3 medulloblastoma -1.100 1.9e-02
interstitial cystitis -1.200 2.5e-03
intraductal papillary-mucinous adenoma (... 1.400 5.8e-04
medulloblastoma, large-cell -2.500 6.4e-06
non-small cell lung cancer 2.133 5.2e-14
oligodendroglioma -1.300 1.3e-02
ovarian cancer 1.200 2.2e-03
primitive neuroectodermal tumor -1.500 3.1e-03
spina bifida -1.672 4.0e-02

Gene RIF (5)

AA Sequence

MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDS      1 - 70
LKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPC     71 - 140
ECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERL    141 - 210
QQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD                           211 - 257
//

Text Mined References (22)

PMID Year Title